voyage en oman

Le JavaScript semble être désactivé sur votre navigateur. Javascript doit être activé dans votre navigateur pour que vous puissiez utiliser les fonctionnalités de ce site internet.

• Afrique du sud
• Burkina Faso
• Corée du nord
• Corée du sud
• Philippines
• Pays Baltes
• République Tchèque
• Nouvelle-Calédonie
• Nouvelle-Zélande
• Polynésie Française
• Arabie saoudite
• Azerbaïdjan
• Emirats Arabes Unis
• Kirghizistan
• Ouzbékistan
• Iles Canaries
• Iles Cyclades
• Ile Maurice
• Iles Salomon
• Rép. Dominicaine
• Voyage de noces
• En septembre
• En novembre
• En décembre
• En amoureux
• À la Toussaint
• À Noël et au Nouvel An
• Circuit accompagné
• Voyage en famille
• Toutes les inspirations
• Nos événements culturels
• Carnets de voyage
• La Maison de thé
• Qui sommes-nous
• Notre valeur ajoutée
• Notre engagement responsable
• Notre agence de voyage
• Revue de presse
• Demander un devis
• Contactez-nous
• Prendre un rdv
• Me connecter
• Voyage Orient >

Voyage Oman

Votre prochain voyage sera inoubliable

Accès rapide

Parfums mélés de l'Arabie heureuse

Paisible sentinelle de la péninsule arabique, le sultanat d’Oman, ancien empire maritime et carrefour commercial des routes de l’encens et de l’or noir protégé par de puissants forts, est un subtil mélange entre traditions ancestrales et modernité, culture et nature. Un voyage à Oman est une échappée étonnante à travers des paysages somptueux et variés, témoins d'un passé épique sur lequel planent les souvenirs de la reine de Saba et de Sindbad le Marin : désert immense ponctué de djebels et de dunes, wadis irriguant de luxuriantes palmeraies, montagnes escarpées et plages de sable doré, forteresses, villages perchés et souks hauts en couleur, comme celui de Nizwa , la capitale historique du sultanat... En  autotour à Oman , au volant de votre 4 x4, ou en circuit accompagné avec chauffeur, parcourez ce petit pays qui a su préserver son identité. Nous avons sélectionné pour vous les meilleures offres de voyages Oman, comme ce séjour dans le plus beau campement du désert des Wahibas , un moment inoubliable de calme et de sérénité sous un ciel clouté d'étoiles en compagnie des Bédouins qui perpétuent la tradition caravanière ; ce week-end à Zighy Bay, sur la péninsule du Musandam, site spectaculaire de fjords s'avançant dans le détroit d'Ormuz ; ou encore cette escapade à Mascate , authentique, chaleureuse et accueillante, à l'image du pays, qui étend sa blancheur et ses constructions de terre séchée le long de la mer d’Oman. Aux portes de la ville, sur des sites d'une exceptionnelle beauté, s'est implantée une hôtellerie qui tend à faire rentrer Oman dans le club très fermé des stars montantes de l'océan Indien. Découvrez notre extension aux Émirats Arabes Unis , à Dubaï et Abu Dhabi , ou encore notre superbe itinéraire combiné menant à Zanzibar, la légendaire île corallienne. Enfin, n'hésitez pas à nous communiquer vos envies si vous souhaitez créer un voyage sur mesure à Oman à la découverte des légendes d’Arabie. Nos spécialistes du Moyen-Orient vous réservent leurs bons plans, les plus belles excursions, des treks et randonnées insolites pour vos prochaines vacances au soleil...

Affiner votre recherche

Oman, parfums mêlés du Sultanat

Circuit accompagné 9 Jours / 7 Nuits

À partir de 3 000 €*

L'Arabie heureuse : Oman et les Émirats arabes unis

Circuit accompagné 12 Jours / 10 Nuits

À partir de 3 695 €*

Oman, en toute liberté

Autotour 10 Jours / 8 Nuits

À partir de 2 895 €*

À la rencontre d'Oman

À partir de 2 490 €*

Oman entre mer, montagne et désert

Voyage sur mesure 8 Jours / 6 Nuits

À partir de 3 450 €*

Echappée omanaise

Oman et Emirats : entre tradition et modernité

Voyage sur mesure 12 jours / 10 nuits

À partir de 5 795 €*

Mascate prestige, The Chedi

Séjour 4 Jours / 3 Nuits

À partir de 2 130 €*

Flexibilité

Report sans frais sur toutes nos destinations ou remboursement en cas de fermeture de frontière.

Des conseillers spécialistes connaissant dans les moindres détails leurs destinations

Contact téléphonique 24h/24 , 7j/7 pendant tout votre voyage.

Culture & voyage

Les clés pour bien préparer votre voyage  à oman.

Conseils de nos experts, témoignages et coups de cœur

L’AVIS DE FRÉDÉRIQUE, CONSEILLÈRE VOYAGES ORIENT

« Un voyage à Oman est une échappée étonnante à travers des paysages somptueux et variés : désert immense, wadis, montagnes escarpées, plages de sable doré, forteresses, souks hauts en couleur... Il est très facile de rentrer en contact avec les Omanais, sereins et respectueux, et d’échanger lors de promenades en famille, sur les marchés. »

LES 4 COUPS DE CŒUR OMANAIS DE FRÉDÉRIQUE

• Profiter du cadre zen de The Chedi Hotel & Spa Architecture minimaliste, décoration soignée, plage privée et longue piscine : j’adore cet hôtel épuré, reposant. Ici, pas de famille, pas d'enfant... le pied à terre idéal si vous recherchez un cadre calme pour vous ressourcer , face au transparent golfe d’Oman. Un vrai luxe. Les attraits et animations de Mascate ne sont pas loin pour ne pas manquer la découverte de la mosquée du Sultan Qabous, Al Alam, du musée Bait Al Zubair ou encore du quartier très coloré du port de Muttrah.
• Passer une nuit nomade dans le désert des Wahibas Quelle beauté, quel apaisement, dans le décor de dunes ocre et dorées du désert des Wahibas, à trois heures de route de Mascate ! Il faut y passer au moins une nuit pour profiter pleinement de cet environnement exceptionnel, le temps de bivouaquer dans un campement tenu par des Bédouins, de contempler le coucher de soleil sur les dunes, de dîner à la belle étoile. Et de profiter de l’hospitalité légendaire des Bédouins qui vous racontent leur histoire, leurs traditions.
• Se baigner dans les piscines à ciel ouvert des wadis Mention spéciale pour le Wadi Shaab, trésor naturel préservé dans le massif du Hadjar. Une petite traversée en bateau vous conduit sur la rive opposée, d’où vous progressez à pied le long de bassins à l’eau turquoise, à travers palmeraies, plantations, gorges rocheuses, pour découvrir toute une série de piscines naturelles ombragées entourées de grottes et de cascades rafraîchissantes. Un endroit béni au milieu des terres désertiques.
• Voyager dans le temps à Nizwa , du fort aux montagnes du Hajar Dans l’ancienne capitale d’Oman cernée de remparts, vous êtes au cœur du sultanat traditionnel. Découvrez le fort tout en rondeur datant du XVII e siècle, le pittoresque marché aux bestiaux du vendredi, les souks hauts en couleur, où se mêlent dattes, halva, poteries, poignards ( khanjar ) et autres trésors d’artisanat. Puis il faut absolument partir en excursion dans les montagnes oubliées de Jebel Shams : le décor du « canyon d’Arabie » est saisissant.

OÙ PARTIR AU SULTANAT D’OMAN ? Notre top 10 des lieux omanais incontournables

• Mascate , située à l’embouchure du détroit d’Ormuz et entourée par les monts Hajar, qui charme par son accueil et son authenticité et impressionne par sa Grande Mosquée du Sultan Qaboos, quintessence d’une architecture raffinée.
• Salalah , au pied d’un massif montagneux dans la région du Dhofar, berceau des arbres à encens. Dans la deuxième ville du pays, témoin de la tradition omanaise, on découvre les vestiges d’Al Balid, site classé par l’Unesco.
• Le Wadi Shaab , rivière naturelle issue du massif Hajar et se jetant dans le Golfe d’Oman. Un environnement exceptionnel pour la randonnée le long des bassins aux eaux scintillantes.
• Le somptueux désert des Wahibas , dont les dunes impressionnantes formées au gré des vents se colorent de variations orangées et peuvent atteindre 100 mètres de hauteur.
• Les villages authentiques nichés au sommet du Jebel Akhdar , dans un magnifique cadre montagneux.
• Nizwa , capitale historique du sultanat et berceau de l’islam en Oman. Au cœur d’une oasis de palmeraies dominée par le dôme bleu de sa mosquée, Nizwa est réputée pour son artisanat local et ses dattes.
• Sur , petit port tourné vers la mer d’Arabie, célèbre pour ses fabriques de boutres et où perdure un savoir-faire ancestral dans la construction de voiliers traditionnels.
• Sinaw , petite ville du désert aux traditions authentiques avec son marché aux bestiaux, son souk et sa vieille ville dont émane les parfums enivrants des épices d’Orient…
• L’imposante forteresse de Bahla , classée par l’Unesco, au pied du Jebel Akhdar et encerclée de palmeraies.
• Birkat Al Maouz , village fortifié classé au patrimoine mondial pour son système d’irrigation millénaire, le falaj, permettant la culture en étages et la juste répartition de l’eau entre les habitants.

LES BONNES RAISONS DE PARTIR AU SULTANAT D’OMAN Notre top 10 des expériences uniques à vivre à Oman

• Visiter le château fort de Jabrin , véritable joyau de l’architecture omanaise, édifié au XVIIe siècle et réputé pour ses plafonds peints et ses portes sculptées d’influence zanzibarite.
• Partir en excursion nocturne au sanctuaire des tortues de Ras-Al-Jinz et observer la ponte des tortues marines vertes sur la plage.
• Passer une nuit dans le désert des Wahibas , dans un camp bédouin posé au milieu des somptueuses dunes ocre et dorées.
• Vivre l’animation des enchères au marché aux poissons de Mutrah.
• Se prélasser sur les plages de la paisible station balnéaire d’Al Mussanah.
• Plonger dans la magnifique piscine naturelle de Bimmah Sinkhole.
• Suivre les traces du navigateur Vasco de Gama et du géographe Ibn Battuta en s’arrêtant à Qalhat, l’un des plus anciens villages d’Oman en bord de mer, où ils auraient séjourné.
• Opter pour une découverte du pays en autotour , en toute liberté et sécurité : un circuit complet qui permet d’apprécier les incontournables du patrimoine omanais ainsi que la diversité de ses paysages.
• Faire un avec la nature , le temps d’une randonnée dans le désert ou, pour les plus sportifs, d’un trek dans le Jebel Shams , le point le culminant du sultanat qui offre un panorama spectaculaire sur les gorges de Wadi Nakhr, le grand canyon d’Oman.
• Observer le fantastique spectacle des falaises du Musandam se reflétant dans l’eau des fjords, sur la péninsule qui s'avance dans le détroit d'Ormuz.

QUAND PARTIR AU SULTANAT D’OMAN ? La meilleure période pour partir à Oman

La meilleure période pour voyager à Oman s’étend de septembre à mai, quand les températures se situent entre 25° et 30°C.

Voyage sur mesure Oman

Rien de tel qu’un voyage sur mesure à Oman pour découvrir ce petit monde paisible et accueillant, fait de tradition et de modernité, de montagnes et de déserts, de sable et d’eau…

Séjour Oman

Un soleil généreux, une architecture moderne mêlée aux vestiges anciens, des habitants chaleureux et accueillants, les légendes et traditions d’Arabie... voilà ce que vous réserve un séjour à Oman .

Circuit accompagné Oman

Au programme d’un circuit accompagné à Oman : un kaléidoscope de paysages somptueux en vert, bleu et ocre, entre wadis, désert et djebels, villages perchés et souks hauts en couleur, un soleil généreux, des sourires chaleureux.

Autotour Oman

Désert immense, oasis luxuriantes, plages de sable doré, forteresses, villages haut perchés, souks hauts en couleur... Les voyageurs avides de liberté choisiront la formule autotour Oman pour un voyage à leur rythme et en toute liberté.

Modules et excursions Oman

Nos experts orientalistes vous ont concocté une palette d’ excursions à Oman , la meilleure manière de personnaliser votre voyage sur mesure ou de compléter nos itinéraires, en extension de votre circuit accompagné.

Découvrez Oman autrement :

Voyage culturel Oman

Bien-être, détente et spa Oman

Hors des sentiers battus Oman

Voyage en famille Oman

Besoin d'un conseil ?

01 56 81 38 30

Prendre un rendez-vous

• Nos villes et étapes à Oman
• Nos suggestions de voyage
• Infos pratiques

Vous arrivez à Mascate . Après un tour d'orientation de cette capitale miniature, cap sur Nizwa et ses souks, à travers la vallée de Sumail, en faisant étape à Bahla, réputée pour ses artisans potiers. Consacrez une journée à la découverte du Djebel Shams , zone montagneuse de l'arrière-pays. Au village de Sinaw , vous aurez une bonne approche de la vie quotidienne des bédouins omanais. Admirez les sables ocre ou dorés des Wahibas avant de rejoindre le port de Sur . Un week-end à Zighy Bay est idéal pour découvrir les fjords spectaculaires de la péninsule du Musandam ou accéder au village de Sabatyn, avec ses pétroglyphes et habitations anciennes.

Voyage Arménie

Voyage Azerbaidjan

Voyage Emirats Arabes Unis

Voyage Dubaï

Voyage Georgie

Voyage Iran

Voyage Israël

Voyage Jordanie

Voyage Kazakhstan

Voyage Kirghizistan

Voyage Liban

Voyage Ouzbékistan

Voyage Turquie

Inscrivez-vous à notre newsletter pour recevoir nos inspirations de voyage en avant-première

Soyez informé en avant-première de tous nos voyages et de tous nos circuits

• Contact : [email protected] Prendre un rendez-vous en ligne 76, rue Bonaparte Paris 6 ème Europe & Orient : 01 56 81 38 30 Inde : 01 56 81 38 38 Asie : 01 40 51 95 15 Chine : 01 40 51 95 00 Afrique & océan indien : 01 56 81 38 29 Amérique du Nord : 01 53 63 13 43 Amérique Latine : 01 53 63 13 40 Australie & îles du Pacifique : 01 70 36 35 40
• Qui sommes nous ?
• Notre Maison de thé
• Nous rejoindre
• Votre agence de voyage à Paris
• Votre voyage de A à Z
• Voyage groupes
• Idée voyage
• Écotourisme
• Voyage sur mesure
• Nos brochures
• Calculateur CO²
• Sécurité & confidentialité
• Conditions générales de vente
• Conditions générales d'utilisation
• Mentions légales
• Charte avis voyageur

© Les Maisons du Voyage

Oman Travel Guide: Ultimate 10-day Travel Itinerary

Oman is a country at the border of the United Arab Emirates. It’s a 1-hour flight from Dubai or a 9-hour flight from Amsterdam and brings you a real Arab experience. Oman has countless sand dunes, green ravines filled with palm trees, huge mountain ranges, emerald green natural pools, and a massive part of the country is located on the seaside. Read this complete Oman travel guide.

Oman is really well developed; the majority of the people speak English and are modern in their way of thinking. Infrastructure is one of the best out there, but they don’t want to be the next Dubai. The buildings that are built have the original Arab look with a modern touch. If that wasn’t convincing enough, the country is voted as one of the cleanest and safest countries in the world. This 10-day route will take you around the best highlights of Oman.

Oman Route Guide

Oman is a huge country, and to see the entire country, you will probably need 2-3 weeks. We narrowed it down to a 10-day self-driving route. This is one of the best countries to drive around yourself. The infrastructure is perfect, the people are super friendly, and petrol is affordable.

We recommend to rent a car in Oman through Sunny Cars with free cancellation and insurance included. Book your rental car here .

Day 1 – 2: Explore Muscat

Muscat is Oman’s capital city and home to many expats. It hosts the impressive Sultan Qaboos Mosque, Muttrah Souq, and the Royal Opera House.

Sultan Qaboos Mosque

The Sultan Qaboos Mosque is Oman’s most important spiritual site. This architectural masterpiece opened in 2001. It’s required for both men and women to wear long sleeve tops and long pants to the ankle. For women, bring a scarf to cover your hair.

The mosque’s entrance is free. It is open to non-muslims every day from 8 AM to 11 AM except Friday. Friday is prayers day.

Book a Muscat City Tour .

Muttrah Souq

Oman citizens are a big mix of Omani, Indian and African people. You can notice this at Muttrah souq where many shops are selling Omani and Indian items. But also everyday items you use in your kitchen.

Tip: Fridays and Saturdays are weekend days and some parts of the souq will be closed.

Read more: Best things to do in Oman

Lunch at Kargeen

The restaurant Kargeen is a small great hideout in the middle of the city. Escape from the heat of the sun and have a great lunch at this well-decorated place.

In Muscat, we stayed at the beautiful Kempinski Hotel Muscat .

Hotels in Muscat 😴

Go on a dolphin-spotting trip

Spend the morning on a boat spotting dolphins just out of Muscat. It is almost guaranteed that you will see dolphins. A morning tour should cost OMR 17 (45 USD).

Here are all your hotel options in Muscat.

Day 3 – 4: Muscat to Sur

After those first two days, drive down the perfect route towards the coastline. This is an easy 90-minute drive, all highway.

Tip: Wear or take swim clothing on this day.

Bimmah Sinkhole

After a good 90 minutes of driving, you will reach Bimmah Sinkhole. This is probably one of the most incredible natural swimming pools you will ever see. The water is a beautiful turquoise color and one of the best cooldowns during the heat of the day. The story lives that a meteor created the hole.

Find day trips to Bimmah Sinkhole

Wadi Shab meaning gorge between the cliff is a must-visit! From Bimmah Sinkhole, drive about 20 minutes to reach the parking spot.

Make sure to buy some extra water and head to the river. Pay 1 OMR to cross the river, from there it’s a 45 min walk to the swimming point. You will need about 3 – 4 hours here. Book a day trip here or find more information in the link down below.

Read more: 7 best things to do in Oman

Sur is formerly known as a trading point where the harbor did a lot of business with East Africa. Because of this, you will see a larger population of people of African ethnicity in this area.

Sur is a beautiful town surrounded by old architecture, visit the lighthouse, fort and see some of the real local life. Sur is also a good place to spend the night.

Tip: Have a good lunch at Zaki Restaurant .

Turtles nesting ground

At Ras Al Jinz, which is about 35 minutes from Sur, there is a protected turtle nesting area. You can visit the museum and join the turtle spotting tour during sunrise or after sunset. If you don’t want to drive back and forward to Sur, you can also spend the night here .

Hotels in Sur 😴

Day 5 – 6: Desert days

From Sur, follow your way to the desert and stop in between at Wadi Bani Khalid. Take a refreshing dip and drive to your desert camp in the Wahiba Sands. Most of the camps can be reached by driving a 4×4 yourself but do ask your host, they might arrange a pick-up. If you are planning to drive yourself, deflate your tires a bit at one of the local shops.

Plan to stay two nights in the desert, explore the area by car or by foot, go stargazing, and experience living between the dunes

Find all:   Desert Camps to stay

Hotels in Oman Desert 😴

Day 7 – 8: Nizwa

On day 7 you will drive the longest distance. Follow your journey to Birkat Al Mouz, one of the old villages surrounded by green banana plantations. Use around 1 hour to explore the ruins here. The drive from the desert takes about 2 hours.

From Birkat Al Mouz, drive to the historical town called Nizwa. See one of Oman’s oldest forts, Nizwa Fort, and wander around at Nizwa Souq. Read more about the fort in the link down below.

Book a Nizwa City Tour

The next morning, hop back in your car and drive to the Al Hamra region. Set course to Misfat Al Abriyeen, where you can spend the night at a homestay in a beautiful area. Make sure to be early, to fully experience the magical sunset.

Day 9 – 10: Cool down in the Mountains

One your last days, drive up to Jabal Akhdar and spend the night at 2000 meters above sea level. To drive up here you are required to have a 4×4 car. Same as Al Hamra, make sure to be there early to fully experience the sunset.

The next morning, enjoy a lovely breakfast before driving back to Muscat to catch your flight.

Getting around in Oman

Oman is probably one of the best countries to get around by yourself. Infrastructure is very, very good and fuel is cheap. To follow this 10-day Oman route guide you will need a 4×4 in the desert and up in the mountains. Renting a 4×4 costs around $950 for 10 days.

Google Maps turn-by-turn navigation doesn’t work in Oman, but on iOS, there’s another app called ‘Here we go’ which works perfectly.

Best time to visit Oman

Oman is best to visit during their winter, which runs from October until March. The temperature will be between 20 and 30 degrees. Summer temperatures go anywhere from 35 to 50 degrees.

If you’re planning to visit the mountains like Jabal Akhdar, you should plan a visit in summer when temperatures rise from 0 in winter to 30 in summer.

Food in Oman

The food in Oman is a mix of Arabian and Indian kitchens. You will mostly find delicious bread, curries, dates, and kebabs.

Oman Route Guide: Oman Visa

Getting a visa in Oman is super easy. E-visa can be requested online . It will cost you around $45 per visa, depending on the country you are from. It takes anywhere from 2 days to 1 week to receive your visa via email.

Order your Visa online here

What to wear in Oman

Oman is very modern and open in what you wear. They don’t give you a set of clothing rules once you enter the country. It is respectful to always cover up your upper body, shoulders, and wear shorts or skirts over your knees.

Again, Omani people are very modern and they will only really ask you to cover up when you are on a religious site.

Costs of traveling in Oman

Oman is not a budget travel country. Prices change depending on the kind of comfort you would like.

Costs of Traveling in Oman

Travel on a budget in Oman, from $230 − $140 USD weekly per person, mid-range $830 − $1950 USD, and high-end from $1860 − $2580 USD. However, costs depend on factors like accommodation, transportation, and activities. We did not include flights. Check flight prices here

• Hotels: $50 − $120 USD Check available hotels
• Car Rental: $65 − $140 USD Book a rental car
• Food: $20 − $60 USD
• Activities: $10 − $40 USD See tickets & tours
• Sim: $1 − $3 USD Get an eSIM or SIM here
• Travel Insurance: $2 − $6 USD Get Travel Insurance

Be advised: Drones in Oman are not allowed without a license.

By purchasing through our links, you support us at no additional cost. Thank you for your support. ♥️

• Find Hotels via Booking.com
• Find a Rental Car via Sunny Cars
• Find Cheap Flights via Skyscanner
• Get a Travel Insurance via Heymondo
• Book Tours & Attractions via GetYourGuide
• Book a Bus/Train/Transfer via 12Go

7 Best Things To Do in Oman

Renting a car in oman in 2024: all you need to know.

Looking for more travel information? Plan a chat with us for personalised travel advice or get an answer from the Salt in our Hair Travel Community on Facebook.

Thank you for writing such a nice Blog, really very helpful, keep writing.

Your email address will not be published. Required fields are marked *

  Notify me when new comments are added.

PREPARE TA VALISE - LE BLOG VOYAGE DE JULIE & NICO & MATTÉO

REJOINS-NOUS POUR SUIVRE NOS AVENTURES EN FAMILLE À TRAVERS LE MONDE !

preparetavalise

• 18 min de lecture

Road trip à Oman : notre itinéraire de 10 jours

Dernière mise à jour : 28 févr. 2023

Le Sultanat d’Oman est un pays du Moyen-Orient situé au sud de la péninsule d’Arabie, frontalier aux Emirats Arabes Unis (donc pas très loin de Dubaï). Recouvert aux trois quarts de montagnes, de désert mais aussi de canyons, c’est un pays qui promet des paysages spectaculaires. Ici, on respecte les coutumes et on vit au rythme des prières. Ses locaux bienveillants et souriants ; ses paysages surprenants ; son odeur d’encens partout, tout le temps ; son ambiance apaisante ; son authenticité… Un ensemble qui fait que Oman est aujourd’hui l'un de nos voyages préférés tant on a été séduits. Bientôt 2 semaines que nous sommes rentrés lorsque je vous écris ces premières lignes et je suis déjà bien nostalgique. Notre road trip à Oman restera un merveilleux souvenir.

Préparer son voyage à Oman : infos pratiques

Visa : faire la demande directement sur internet 2 semaines avant le départ. Nous avons reçu les nôtres quelques minutes après avoir envoyé le formulaire,

Passeport : valide 6 mois après la date de retour en France,

Monnaie : le rial Omanais : 1 OMR = environ 2 €,

Décalage horaire : + 2h en été / +3h en hiver,

Langue : arabe et anglais partout,

Transport : véhicule de location, 4x4 indispensable pour aller dans le désert mais aussi pour monter au plateau de Sayq (Djabel Akhdar). Attention à bien respecter les limitations de vitesse, il y a beaucoup de radar à Oman,

Internet : on a souscrit l’offre à 29€ avec notre opérateur français pour 10Go mais vous pouvez vous procurer une carte sim pour 16€,

Quand y aller : de novembre à avril pour avoir des températures plus fraiches (25 à 30 degrés en moyenne),

Combien de temps : entre 10 et 15 jours, pour pouvoir rajouter à notre itinéraire la péninsule du Musandam et pourquoi pas Salalah au sud du pays,

Indispensable dans la valise : crème solaire, chaussures d’eau, casquette/chapeau, pull pour le désert,

Tenue vestimentaire : afin de ne pas importuner les locaux et respecter leur culture, veillez à avoir les épaules et les jambes couvertes. Si vous êtes une femme, on vous demandera également de couvrir votre tête pour visiter la mosquée de Mascate. Pour la baignade, plusieurs panneaux rappellent aux touristes de porter un tee-shirt et un short. S’il vous plait, respectez les consignes .

Bon à savoir :

- Le vendredi à Oman c’est un peu le dimanche en France, beaucoup de choses sont fermées,

- Les Omanais sont très attachés à l’hygiène. Leur apparence est toujours soignée et ils sentent très bon,

- Il est interdit de crier,

- Il est rare de croiser des femmes, très souvent ce sont les hommes qui font les courses,

- Un homme peut avoir 4 femmes s’il souhaite, mais il doit leur offrir la même vie.

La solution idéale pour réserver vos vols et voitures de location

On passe toujours par Expedia pour réserver nos vols et notre voiture de location : une solution simple, pratique et très abordable. Avec leurs filtres de recherche, on trouve facilement ce que l’on cherche en fonction de nos critères et de notre budget. Si vous cherchez une solution rapide et efficace pour réserver vos vols ou une voiture de location, on vous conseille de passer par Expedia.fr .

Road trip à Oman : avec un bébé ?

La question est revenue de nombreuses fois sur les réseaux sociaux, la réponse est OUI. Rien de particulier à signaler, on s’est senti en sécurité tout le long de notre séjour, les enfants sont appréciés dans le pays.

Vous trouverez des « carrefour » dans les grandes villes pour pouvoir acheter des produits particuliers à votre bébé (pomme pot’, lait, couches, petits pots) mais, ceci dit, on a aussi acheté des couches Pamper’s dans une petite alimentation à Tiwi.

La cuisine est savoureuse mais pas vraiment épicée, Mattéo (2 ans) n’a pas eu de difficulté à manger comme nous. Lorsque nous avions des doutes sur l’abus d’épices, nous lui commandions des frites, avec un Lemon-Mint (une citronnade à la menthe) ; c’était le plus heureux.

Portez une attention particulière à l’hydratation de votre enfant, il peut vraiment faire très chaud.

Itinéraire de notre road-trip de 9 jours à Oman :

Jour 1 : Nizwa

Jour 2 : Misfat

Jour 3 : Mascate

Jour 4 : Bimmah Sinkhole / Wadi Shab

Jour 5 : Wadi Tiwi

Jour 6 : Sour

Jour 7 : Ras Al Hadd

Jour 8 : Wadi Bani Khalid

Jour 9 : Sharqiya Sands

Road trip à Oman – Jour 1 : Que faire à Nizwa ?

Depuis Dubaï, il nous a fallu un peu moins de 6h (4h30 de route + 1h pour passer la frontière à Al-Aïn) pour arriver à Nizwa. Cette ville s’impose comme une étape incontournable lors d’un séjour dans le Sultanat d’Oman. Ancienne capitale du pays, on vient à Nizwa pour découvrir son fort, ses souks et déguster la halwa, une douceur locale à base d’eau de rose, de sucre et d’épices, réputée pour être la meilleure du pays.

Situé au pied du fort, le vieux souk de Nizwa est le meilleur endroit pour se retrouver au contact des locaux. L’ambiance est animée, les produits sont variés (poteries, encens, épices, dattes, fruits & légumes, etc…) et les senteurs sont exaltantes.

Sachez que le vendredi matin, très tôt, se tient le marché aux bestiaux. Les hommes en tenue traditionnelle vendent leurs bêtes aux enchères. Un spectacle que nous n’avons pas pu voir puisque nous avons visité Nizwa le lundi.

Le Fort de Nizwa

Le Sultanat d’Oman compte plus de 500 forts éparpillés un peu partout dans le pays. Construit à la fin du 17eme siècle et parfaitement rénové, le fort de Nizwa est aujourd’hui le fort le plus visité d’Oman. Déambuler dans les nombreuses salles fraiches, grimper sur les toits, jouer à cache-cache avec Mattéo mais aussi déguster une délicieuse crêpe fromage/miel sont les raisons pour lesquelles cette visite fût très agréable.

N’oubliez pas de monter au sommet de sa tour, elle offre un panorama à 360° sur les montagnes Jebe Akhdar, le dôme de la mosquée et l’oasis.

Infos pratiques : ouvert tous les jours de 8h à 18h, sauf le vendredi 8h à 12h. Le prix est de 5 OMR par personne, environ 12 €.

Où dormir à Nizwa ?

Nizwa Heritage Inn : situé à quelques pas du souk, l’emplacement est idéal pour visiter Nizwa. Cet hébergement traditionnel rénové possède une terrasse sur le toit, très agréable pour se reposer ou prendre un café. Le petit déjeuner est sous forme de buffet. Pour accéder aux places de parking devant l’hôtel, ne suivez pas votre GPS qui va surement vous faire prendre des ruelles très très étroites. Passez devant le fort pour rentrer dans le vieux Nizwa. Prix : 50€ la nuit avec petit déjeuner.

Où manger à Nizwa ?

Nous avons mangé au restaurant Al Aqur Traditional situé juste en face de notre hôtel. 26€ à 4 pour un plateau de viande mixte + crudités/pita et des softs.

Road trip à Oman – Jour 2 : Misfat, en passant par Djebel Akhdar

Le massif du Hajar occidental réserve des paysages de folie, avec d’un côté Djebel Akhdar et de l’autre Djebel Shams. Pour cette deuxième journée, nous avons choisi d’explorer le Djebel Akhdar avant de nous diriger vers Misfat (ou Misfah) al Abriyeen, au détriment du Jabel Shams et du plus grand canyon d’Arabie. Parfois il faut faire des choix et celui-ci a été vraiment difficile !

Diana’s Viewpoint

Le Djebel Akhdar, culminant à + de 3000 mètres d’altitude, doit son nom de montagnes vertes aux jardins en terrasses qui se trouvent sur ses flancs. Avant de pouvoir rouler dans cette partie du Hajar, un barrage de police vérifie les papiers du véhicule et contrôle qu’il s’agit bien d’un 4 roues motrices. Ça grimpe fort jusqu’au plateau de Sayq, les canyons apparaissent et les paysages sont impressionnants. Le Diana’s Viewpoint se trouve à l’intérieur de l’ hôtel Anantara mais vous pouvez aussi continuer jusqu’au bout de la route, marcher 2 minutes et admirer le paysage.

Infos pratiques : voici les coordonnées GPS 23.066447, 57.671446

Où manger au plateau de Sayq ?

Robou alsaab trade : c’était le seul restaurant ouvert lors de notre passage. Nous avons commandé du moutabal, du houmous, des manakeesh épinard/labneh et encore et toujours des lemon mint pour un total de 15€ pour 5. C’est pas de la grande cuisine, mais ça dépanne.

Misfat al Abriyeen

Situé sur le flanc des montagnes, dans la province d’Al Dakhiliyah en Oman, Misfat est un village à ne pas manquer : c’est un véritable coup de cœur pour nous. Cette densité de vert, dans un décor aussi aride nous a laissés sans voix. C’était très agréable de se balader le long des petits canaux datant de l’époque Perse, appelés Falaj. Dans cette palmeraie, qui fut un excellent terrain de jeu pour Mattéo, nous pouvions écouter les oiseaux entre 2 appels à la prière. Si vous le souhaitez, vous pourrez emprunter un des sentiers de randonnée pour explorer d’un peu plus prêt la montagne aride.

Bien que le vieux Misfah soit très peu habité, vous pourrez lire sur un panneau à l’entrée du village quelques règles à respecter comme celle de dire bonjour aux gens ou encore de couvrir vos bras et vos genoux.

Infos pratiques : avant de nous rendre dans le vieux Misfah, nous nous sommes arrêtés à des endroits plutôt photogéniques que vous pourrez découvrir par vous même si le cœur vous dit.

1er stop : une vue sur le village de Al Hamra. Nous sommes ensuite passés dans la palmeraie en direction de Misfat. Coordonnées GPS : 23.116631, 57.278392 ,

2e stop : une vue sur le village de Misfah al Abriyeen. Coordonnées GPS : 23.137750, 57.308635 .

Où dormir et manger à Misfat ?

Misfah Old House : situé en plein cœur de la palmeraie, cet hébergement est l’endroit idéal pour déconnecter. Les chambres sont simples et les lits posés à même le sol. Nous avons profité de la terrasse sur le toit pour diner, c’était très agréable. Le diner est servi sous forme de buffet et est complet : poulet, riz, poisson au curry, dahl (un des meilleurs que nous avons pu manger à Oman et croyez-moi, on en a mangé un paquet de fois !) et fruits/gâteaux pour le dessert. Le petit déjeuner, même principe. Prix : 130€ la nuit avec petit déjeuner.

Road trip à Oman – Jour 3 : Que faire à Mascate ?

Nichée entre mer et montagnes, Mascate est la capitale du Sultanat d’Oman. Bien qu’elle soit l’une des plus petites capitales au monde, cette ville est très étendue. Il est nécessaire d’avoir une voiture et une bonne organisation pour la visiter sans perdre de temps. Si autrefois Mascate n’était qu’un port de pêche, elle s’est développée rapidement ces dernières années mais a su conserver son authenticité. Que faire à Mascate en une journée ? Voici les 5 endroits que nous avons pu visiter .

La Grande Mosquée du Sultan Qaboos

Financée par le Sultan Qabus ibn Said, la Grande Mosquée du Sultan Qaboos est la plus grande du pays. Elle est composée d’un dôme central d’une hauteur de cinquante mètres et de 5 minarets qui représentent les 5 piliers de l’Islam. Dans la grande salle de prière vous trouverez un spectaculaire lustre central en cristal ainsi que le plus grand tapis persan artisanal réalisé dans le monde. Cette salle est réservée aux hommes lors des prières mais les femmes sont autorisées à la visiter.

Lors de notre voyage au Maroc , nous étions frustrés de ne pas pouvoir découvrir l’intérieur des mosquées alors nous attendions la visite de la Grande Mosquée de Mascate avec impatience. Nous avons exploré chaque recoin : tout est homogène, c’est sobre, propre, beau, accueillant et incroyable comme on s'y sentait bien !

Infos pratiques : ouverte tous les jours de 8h à 11h, sauf le vendredi. L’entrée est gratuite. Les jambes et les bras doivent être couverts, ainsi que les cheveux pour les femmes. Il est possible pour les non musulmans de rentrer dans les salles de prières, en vous déchaussant évidemment.

Royal Opera House of Muscat

Avec son architecture imposante et luxueuse, c’est une visite à ne pas manquer lors de son séjour à Mascate. Si de l’extérieur l’opéra royal est un chef-d’œuvre, vous serez également surpris par les décors en bois qui se trouvent à l’intérieur. Cet opéra peut accueillir jusqu’à 1100 spectateurs et c'est le seul au monde à posséder un orgue.

Infos pratiques : l’Opéra Royal de Mascate est ouvert tous les jours de 8h30 à 17h30 et fermé le vendredi. Vous pouvez consulter le programme sur le site internet de l’Opéra .

Souk de Mutrah

Situé sur la corniche, à deux pas du Palais du Sultan, le souk de Mutrah est un incontournable à Mascate. Les yeux fermés, vous trouverez l’entrée du souk grâce à l’odeur d’encens qu’il dégage. Entièrement couvert, vous trouverez ici des bijouteries, des pashminas, des luminaires mais aussi toutes sortes de souvenirs. Contrairement à ce qu’on peut vivre au Maghreb, personne ne vous appellera la gazelle et vous prendra la main pour vous tirer dans l’une des boutiques . Dans le souk de Mutrah les vendeurs vous inviteront simplement à regarder mais sans jamais insister. C’est vraiment une partie de plaisir que de venir acheter quelques souvenirs ici.

Infos pratiques : parce que j’adore vraiment l’odeur des Omanais, j’ai discuté avec un vendeur qui m’a expliqué qu’ici les hommes portent tous des dishdasha (tenues traditionnelles) et qu’ils ont des petits pompons sur le côté qui servent à mettre du parfum. Voilà leur secret !

Corniche de Mutrah

Animée aux heures les plus douces (matinée et soirée), ce lieu de promenade est particulièrement apprécié par les Omanais. Vous pourrez admirer les bâtiments du front de mer, la Mosquée Bleue, le fort, l’encensoir géant, les parcs et aussi les bateaux traditionnels. Pour découvrir un joli panorama sur la capitale, vous pouvez visiter le fort de Mutrah.

Plage Qurum

Située à 15 minutes en voiture du Souk de Mutrah, elle fait partie des plus belles plages de Mascate. Bien qu’elle soit légèrement plus fréquentée que les autres, elle reste très paisible et agréable. C’est l’endroit idéal pour admirer le coucher de soleil alors c’est ici que nous avons choisi de terminer notre journée. Après un petit bain, Mattéo a joué au ballon avec d’autres enfants pendant que nous profitions des derniers rayons de soleil.

Conseils : parce que je pourrais l’écrire 40 fois dans cet article, il y aura toujours des touristes qui feront comme chez eux, alors encore une fois, oui j’insiste, si vous vous baignez évitez le bikini !

Que faire à Mascate si vous y restez plus d’une journée :

Visiter le National Museum of Oman,

Passer devant le palais du Sultan,

Excursion pour rencontrer les dauphins,

Visiter la Mosquée Muhammad al-Amin.

Où manger à Mascate ?

Bait al Luban : le meilleur restaurant de notre road trip à Oman. Installés sur des coussins à même le sol pour le plus grand plaisir de Mattéo, nous avons goûté à leur soupe de lentilles, leur shuwa, leur harees dijaj et leur lemon-mint (pour changer !) qui est le meilleur du pays. Prix : 150€ à 5,

Kargeen : manger un buffet avec des spécialités dans une jolie décoration orientale. Vous pourrez également manger une pizza ou encore fumer une chicha,

Ushbar : un autre très bon restaurant où nous avons pris des salades fatoush, des machboos, du houmous et des lemon mint.

Où dormir à Mascate ?

Fort Guesthouse : à deux pas de la corniche, vous trouverez dans cet hôtel de style omanais, des chambres pleines de charme. La terrasse est très agréable. Difficile de trouver mieux en rapport qualité/prix. Prix : 50€ par couple.

Road trip à Oman – Jour 4 : Bimmah Sinkhole / Wadi Shab

Nous quittons Mascate pour découvrir la côte orientale d’Oman. Les paysages sont, comme depuis le début de notre séjour, incroyables. Nous roulons pendant une bonne heure le long du littoral, au pied des monts Hajar. La région qui s’étend de Mascate à Sour bénéficie de nombreux attraits touristiques. Si vous avez un peu plus de temps que nous, vous pourrez vous rendre au Wadi Al Arbeieen avant de découvrir le Bimmah Sinkhole et de continuer jusqu’au Wadi Shab. Faites également quelques arrêts le long de la mer pour découvrir les plages d’Oman mais aussi pour observer les tortues. Nous avons eu la chance d’en voir depuis la plage : un moment unique, que nous avons particulièrement apprécié.

Bimmah Sinkhole

Egalement appelé “Bait Al Afreet” par les Omanais, le Bimmah Sinkhole est une curiosité naturelle qui se trouve dans le Najm Parc Hawiyat, à ne pas manquer lors d’un road-trip à Oman. Ce trou d’eau turquoise est assez magique.

Cependant, nous avons un avis assez partagé sur ce lieu. Pour ma part, j’ai adoré me baigner dans cette piscine naturelle et profiter gratuitement d’une fish-pédicure, surtout que nous avons eu la chance d’être seuls lors de notre passage au Bimmag Sinkhole. Mais Jérôme, le cousin de Nico avec qui nous partagions notre voyage à Oman, n’a pas apprécié l’aménagement qui dénature complètement le lieu (béton, aire de pique-nique, jeux pour enfant).

Infos pratiques : le parc est ouvert à partir de 8h, si vous voulez arriver tôt pour pouvoir profiter du lieu dans le calme, sans touristes. Ceci dit, nous y étions aux alentours de midi et il n’y avait vraiment personne. Peut-être un coup de chance...

Situé dans la région d’Al Sharkiyah, à seulement quelques minutes de Tiwi, Wadi Shab est l’un des wadis les plus connus du Sultanat d’Oman et c’est aussi mon préféré. Nous arrivons en milieu d’après-midi, beaucoup de voitures sont déjà garées sur le parking. Pas de temps à perdre, nous embarquons dans un petit bateau pour 1 OMR (soit 2€) par personne avec notre guide. Il n’est pas nécessaire de prendre un guide, vous trouverez le chemin facilement. Sachez juste que les derniers retours en bateau se font à 17h30 sans guide donc si vous arrivez assez tard dans l’après-midi comme nous et que vous ne voulez pas vous pressez, nous vous recommandons de prendre un guide ou de faire la traversée à la nage.

Arrivés de l’autre côté de la rive, nous commençons la randonnée. Il nous a fallu 45 minutes de marche (avec Mattéo dans le porte-bébé ) au cœur du canyon, le long des parois abruptes, pour rejoindre les piscines. Nous déposons nos affaires sur un rocher et partons nous baigner. Faisant fuir les derniers touristes, nous profitons de cet endroit incroyable seuls.

Je suis restée seule avec Mattéo, le temps que les garçons en compagnie de notre guide remontent la rivière. Après 20 minutes de randonnée aquatique, ils passent à la nage dans un couloir très serré et tombent sur une jolie cascade. Impossible de s’y rendre avec un bébé.

Infos pratiques : n’oubliez pas de prendre avec vous une bouteille d’eau, de la crème solaire, un sac étanche et de quoi vous couvrir la tête car la chaleur peut être écrasante.

Où manger à Tiwi ?

Anwaar : peu de choix de restaurant à Tiwi, nous nous sommes arrêtés dans celui-ci un peu par hasard au bord de la route. Beaucoup de plats indiens, nous commandons des chikens tikkas.

Où dormir à Tiwi ?

Tiwi Sunrise : idéalement situé lorsque l’on veut visiter Wadi Shab et Wadi Tiwi, cet hôtel possède des chambres spacieuses et une piscine. Prix : 50€ par couple.

Road trip à Oman – Jour 5 : Tiwi

Pour ce 5e jour de road trip, nous ralentissons le pas. Nous prenons notre temps le matin avant de partir explorer Wadi Tiwi, puis nous nous arrêtons à la plage avant de prendre la route vers Sur (ou Sour).

Surnommé « la gorge aux 9 villages », le Wadi Tiwi se mérite. En 4x4, longez le wadi pendant 30 minutes jusqu’au village de Mibam. La route est étroite et sinueuse, si c’est compliqué pour le conducteur sachez que ça l’est aussi pour les passagers. Plusieurs fois j’ai fermé les yeux en pensant que la montée était rude, mais que la descente serait pire !

Nous avons trouvé très peu d’informations pour nous y rendre, nous avons galéré pour vous. Voici les coordonnées GPS du parking de Mibam : 22.7730539,59.2155269 . Si des Omanais vous demande de vous garer avant c’est qu’il n’y a plus de place après, écoutez-les. Ils peuvent également vous guider à travers les palmiers dattiers et les cultures en terrasses pour descendre jusqu’aux piscines naturelles. Sinon, au bout de la route, un escalier en béton descend jusqu’à la cascade.

Arrivés en bas, les piscines sont très glissantes et il est impossible de descendre plus bas avec Mattéo en porte-bébé . Nous nous baignons au pied de la cascade avec les quelques locaux qui sont déjà présents.

Infos pratiques : de nombreux locaux viennent aussi se rafraichir ici, alors baignez-vous habillé. N’oubliez pas de prendre vos chaussures d’eau.

Aussi connue sous le nom de « pebbles beach », cette plage de galets est l’une des plus belles plages d’Oman. Les locaux se garent directement sur la plage avec leur 4x4 mais c’est tellement étendu que ce n’est pas dérangeant. En regardant au large, nous avons pu observer quelques tortues. C’est toujours un plaisir de les voir dans leur milieu naturel.

Road trip à Oman – Jour 6 : Que faire à Sur (ou Sour) ?

Situé sur le Golfe d’Oman, Sur est la capitale de la province d’Ash Sharqiyah. Rythmée par les marées et le va et vient des bateaux, cette ville maritime est très agréable. Ce n’est pas une grande ville et une seule journée suffit pour la visiter.

Le vieux Sur

Séparé du reste de la ville par un bras de mer, le vieux Sour se visite à pied. Si l'on y vient c’est surtout pour voir phare d’Al Ayjah et la vue qu’il offre sur la corniche.

La corniche & la plage

Si vous souhaitez vous baigner dans la vie quotidienne locale, c’est sur la corniche qu’il faut vous rendre. En fin de journée, les Omanais aiment s’y retrouver pour discuter ou boire un café. Nous passons la fin de notre journée sur la plage à nous reposer, Mattéo jouent un peu plus loin au football avec d’autres enfants. Encore un endroit où nous nous sentons vraiment bien à Oman !

Souk aux femmes

Avant d’aller diner, nous déambulons dans le souk aux femmes. Bien que les hommes puissent s’y balader, ici on trouve que des boutiques pour les dames.

Où manger à Sour ?

Alhawash : entourés de locaux, nous avons commandé des tajines, une salade fatoush, du houmous et toujours nos lemon mint,

Oysters : excellent buffet pour 20€ par personne.

Road trip à Oman – Jour 7 : Journée off à Ras al hadd

Ras al Hadd est un village côtier qui se trouve à la pointe orientale du sultanat d’Oman. Cet endroit est réputé pour ses tortues marines qui viennent par centaines déposer leurs œufs. Cependant, il n’y a pas grand-chose à faire à part se reposer et profiter.

Turtle beach resort

Nous avons décidé de passer notre journée off dans l'hôtel Turtle Beach Resort . Dans un cadre extrêmement relaxant, nous avons profité de la piscine et des transats sur la plage pour 24€ par personne, repas compris. L’établissement possédait des jeux pour enfant pour le plus grand plaisir de Mattéo. Une journée de pause qui nous a permis de recharger les batteries.

Pourquoi nous n’avons pas visité la réserve aux tortues ?

La réserve aux tortues se trouve à une dizaine de kilomètres de Ras al hadd. Sans construction, ni possibilité d’accéder seul à la plage, il faudra passer par le centre d’accueil de la Ras Al Jinz Turtle Reserve pour pouvoir rencontrer les tortues marines.

Il y a quelques années, lorsque les copains Max & Elisa des Best Jobers sont venus à Oman, ils avaient fait le choix de ne pas visiter cet endroit à cause du non-respect des reptiles. Plusieurs commentaires sur internet témoignent des débordements lors des excursions nocturnes : selfies avec les animaux, utilisation du flash, trop de monde autour des tortues etc…

Depuis le Covid-19 est passé par là et un mis un coup au tourisme. Nous avons vu très peu de touristes lors de notre road trip à Oman alors nous étions prêts à nous y rendre et à nous faire notre propre opinion, pensant que le problème était simplement le tourisme de masse. Puis quelques jours avant, un nouveau commentaire sur internet témoignait du non-respect d’observation des tortues et même pire : un guide aurait sorti un bébé tortue de sa poche pour faire croire qu’il venait de sortir de son œuf.

Très heureux de ne pas avoir participé à ce désastre, nous ne pouvons que vous conseiller de passer votre chemin.

Road trip à Oman – Jour 8 : Sharqiya Sands, en passant par Wadi Bani Khalid

La fin de notre séjour à Oman approche. Bien que nous ayons traversé de magnifiques paysages et créé de jolis souvenirs, la suite est prometteuse. C’est probablement la journée la plus attendue de notre road trip. Ce soir, nous dormons dans le désert !

Wadi Bani Khalid

Niché dans le massif du Hajar, le Wadi Bani Khalid est vraiment magnifique. Si c’est l’un des wadis les plus connus à Oman, c’est certainement l’un des plus accessible.

Après s’être garés sur le parking, nous marchons une dizaine de minutes pour accéder au premier bassin. Sur le chemin des panneaux demandent aux touristes de se baigner en tee shirt/short. Il est assez tôt lorsque nous arrivons, seuls quelques Omanais se baignent.

Nous longeons la piscine naturelle jusqu’au fond, puis nous continuons la visite sur les rochers. 10 minutes plus tard, nous posons nos affaires et sautons dans l'un des bassins. Un moment rafraîchissant, vraiment très agréable.

Si vous le souhaitez, vous avez la possibilité de visiter une grotte avec des chauves-souris en marchant une vingtaine de minutes le long du Wadi, les locaux vous aideront à trouver votre chemin sans problème !

Sur le chemin du retour, vers 11h, le lieu est bondé de monde. S’ils n’y avaient que des locaux venus pique-niquer l’endroit resterait agréable mais malheureusement ce sont des dizaines de touristes européens qui parlent très fort et ne respectent pas les règles (baignade en bikini).

Très heureux d’avoir profité de ce petit paradis en compagnie de quelques locaux, nous quittons le Wadi Bani Khalid et reprenons la route en direction du désert.

Sharqiyah Sands

Egalement appelé Wahiba Sands, le désert du Sultanat d’Oman s’étale sur 180 kilomètres du Nord au Sud et 80 kilomètres d’Est en Ouest. Pouvant atteindre jusqu’à 200 mètres de haut, les dunes offrent un paysage aux couleurs dégradées d’ocre et de rouge. Le désert de Sharqiyah Sands est facile d’accès, selon votre itinéraire vous arriverez d’Al Mintirib ou d’Al Wasil. Des rabatteurs sur la route, vous proposeront de dégonfler vos pneus en échange de quelques dollars. C’est la première fois en 8 jours qu’on nous demandait de l’argent en échange d’un service.

De nombreuses activités vous permettront de découvrir les dunes de sable selon vos envies : balades à dos de dromadaire, dune bashing, sortie en quad, rencontre avec les bédouins… L’expérience que vous allez vivre ici sera inoubliable, peu importe le type de logement que vous choisirez. Dans le désert de Merzouga au Maroc , nous avons dormi dans une tente bédouine, ici nous avons pris un logement plus luxueux (en partie pour que Mattéo ait tout le confort nécessaire). Si le coucher de soleil vous offrira des couleurs incroyables, n’oubliez pas de monter en haut des dunes pour voir également le lever du soleil.

Où dormir dans le désert ?

Sama al Wasil Desert Camp : situé au pied des dunes, c’est le dernier camp du désert. Isolé mais facilement accessible, il propose des chalets avec salle de bain privative et climatisation. Le diner sous forme de buffet est exceptionnel et le petit déjeuner très varié. Il y a même un petit cinéma en plein air pour regarder un film le soir avec des pop-corn, quoi de mieux !

Road trip à Oman – Jour 9 : Sharqiya Sands – Retour aux Emirats Arabes Unis

Nous avions mis le réveil à 5h30, pour avoir le temps de monter en haut des dunes et pouvoir profiter du lever de soleil. Si vous lisez notre article détaillé de notre expérience dans le désert, vous verrez qu’il s’agit d’une épreuve très sportive ! Nous avons passé 3 heures (peut-être même 4) au sommet des dunes, dans le silence, avec pour seul objectif de profiter de ce moment incroyable. Cette jolie parenthèse en famille est l’un de mes meilleurs souvenirs de notre road-trip à Oman.

Après avoir déjeuné, nous prenons la route en direction d’Abu Dhabi. Oman est l’un de nos voyages préférés, l’avoir partagé avec les cousins de Montréal – Jérôme & Froilan – lui a donné encore plus de saveurs. Oman, merci ! Merci pour ton authenticité, pour tes odeurs, pour tes paysages magiques, pour tes wadis magnifiques, pour ton accueil, pour ta simplicité, pour ta culture, pour ta sécurité, pour tous ces souvenirs.

Vous avez aimé cet article ? Partagez-le / Enregistrez-le sur Pinterest !

1 comentario

TU VEUX DEVENIR PHOTOGRAPHE OU VIDÉASTE, MAIS TU NE SAIS PAS PAR OÙ COMMENCER ?

Quel matériel choisir comment régler mon appareil quelles sont les bases de la photo comment toujours réussir ses images , découvre 3  formations offertes pour répondre à toutes tes questions, informations essentielles : conseils et astuces pour voyager pas cher.

N'oubli ez pas votre assurance

Une assurance voyage avec une couverture complète vous protégera contre des événements inattendus comme le vol, les annulations, les blessures et les maladies. On utilise   Heymondo   et on la recommande vivement.

Besoin d'une carte bancaire ?

À une époque où les voyages à l'étranger sont de plus en plus fréquent, nous avons tous un besoin d'économiser pour voyager.   N26 est la banque en ligne que nous avons adopté !

A l’image de sa concurrente Revolut , c’est ce qu’on appelle une neobanque : un vrai compte bancaire, une carte Mastercard gratuite avec laquelle vous pouvez payer partout dans le monde dans n’importe quelle monnaie,  SANS AUCUN FRAIS  ! 

Les équipements indispensables pour voyager

Découvrez les  meilleurs accessoires de voyage qui sont essentiels pour la destination que vous visiterez. Ceux-ci sont regroupés en différentes catégories, afin que vous puissiez identifier rapidement les articles en fonction de vos besoins.

Vos articles favoris

14 accessoires de voyage indispensables pour parcourir le monde

Comment négocier en voyage ? 11 astuces pour payer moins cher

Que faire en Provence : 30 endroits à ne pas manquer

25 erreurs de voyage courantes et comment les éviter

Où et Quand partir en voyage ? Calendrier pour chaque mois de l'année

N26 : La carte bancaire idéale pour voyager !

Les 75 plus belles citations de voyage

Cuisine du monde : 15 recettes pour voyager à la maison

The Best Oman Itinerary: A 7-10 Day Road Trip

This page contains affiliate links. Please read our disclosure for more info.

Our Oman itinerary took us on a 10-day road trip around the north of the country.

We visited stunning mosques and sandcastle-like forts, hiked up sand dunes and along the rim of the Grand Canyon, swam in the crystal green waters of wadis, and took long walks on empty beaches.

Oman is one of the safest countries to visit in the Middle East, it’s easy to self-drive, and you’ll have many places to yourself as tourism is only just beginning to grow here. It’s also the perfect place for some winter sun.

If you have less time, you could easily do this Oman road trip in a week.

Oman Road Trip Tips and Resources

Our oman itinerary, our oman road trip map, days 1–2 muscat (2 nights), day 3 muscat – nizwa (2 nights), day 5 nizwa – jebel shams (2 nights), day 7 jebel shams – wahiba sands (1 night), day 8 wahiba sands – ras al hadd (1 night), day 9 ras al hadd – sur (1 night), day 10 sur – muscat (1 night), what to pack for oman, more oman travel tips.

All international visitors require a visa for entry to Oman.

Whilst you used to be able to obtain one upon arrival, visitors are now advised to apply for an Oman eVisa online before you arrive in the country.

Once your visa is approved (usually within a day or so), you must enter the country within 30 days.

Do you need a 4WD in Oman?

Most people recommend a 4WD for an Oman road trip, but they are at least double the price of a regular 2WD car and whether you need one depends on your itinerary.

We decided to rent a small 2WD SUV as it has higher clearance than a regular sedan.

For this route we didn’t need a 4WD except for going up Jebel Akhdar mountain where we hired a driver at the base to take us up.

The road up Jebel Shams was steep and unpaved in parts but we managed in a 2WD.

Most roads in Oman are paved, quiet, and in good condition.

If you can afford it, a 4WD will give you peace of mind and will allow you to explore some of Oman’s exciting off-road tracks, but you can manage without one.

Oman car hire

We rented a Nissan Kicks small SUV through Booking.com for £261 for our 10 days in Oman from the Thrifty office at Muscat airport.

We had a limit of 200km a day which is common in Oman and was plenty for us. Technically you need an international driving permit in Oman but we were never asked for one.

We have a separate annual car hire insurance policy which covered the excess. This is much cheaper than purchasing full insurance with the rental company. 

In Oman you drive on the right. The speed limit is usually 120km/h or 60km/h in urban areas.

Fuel stations are attended—you can leave a small tip but it didn’t seem to be expected. Most stations have a shop and some have toilets and a restaurant. Petrol is cheap—less than 40p a litre.

Accommodation

We booked most of our accommodation on Booking.com , which often worked out cheaper than booking direct.

Everywhere we stayed was well equipped (ensuite, air conditioning, WiFi, free parking) and functional rather than stylish. Hotels add 17% tax.

If you are on a tight budget, the cheapest option is to buy a tent and wild camp for free almost anywhere in the country.

We bought an Omantel SIM card from the desk at the airport.

The “Tourist-5” costs 5 OMR ($13) including 6 GB data (valid for 10 days), 1 GB free and a free Otaxi trip. Other packages are available and the staff speaks English.

The data package was very useful as we used Google Maps for directions. The mobile signal was often faster than the hotel WiFi.

Alternatively, Airalo esim is a great option as you can buy an eSIM through their app for instant connectivity upon arrival.

Oman Travel Costs and Money

The current exchange rate is 1 OMR (Omani rial) = £2.10, €2.40 and $2.60. The rial is divided into 1000 baisa.

There are a few ATMs at the airport and there was no charge to use them with a foreign card. It’s best to stock up on cash as some hotels and petrol stations are cash only.

We spent £134 ($165/€154) a day for two people with the most expensive items being accommodation (£68 a day) and transport (£38 a day).

We found food inexpensive in local restaurants (rather than hotels) and it cost us less than £14 a day (not including the meals that were included in two of our hotels).

We didn’t spend a lot on entertainment as there aren’t many expensive attractions and our favourite activities—hikes and wadis—were free.

Our costs don’t include flights to Oman. We flew Bangkok-Muscat-London with Oman Air. It wasn’t the cheapest option but we preferred to fly direct. You can search Kiwi for the best flight deals.

When to Visit Oman

Winter is the best time to visit Oman as the summers are extremely hot.

Our trip was in early December and the weather was perfect—around 25ºC and sunny during the day with pleasantly cooler nights.

The nights at Jebel Shams mountain and Wahiba Sands desert were very cold and we needed warm clothing.

Travel insurance

Travel insurance is essential in case anything goes wrong on your trip.

We used True Traveller as always—they are the best deal we’ve found for UK residents. Heymondo is another company we’ve used in the past.

We heard mixed reports about whether the water in Oman was drinkable. As I have a sensitive stomach we decided not to risk it and drank bottled water instead.

Back to Contents

• Muscat – 2 nights (stay at Mutrah Hotel )
• Nizwa – 2 nights (stay at Al Karam Hotel Apartment )
• Jebel Shams – 2 nights (stay at Jebel Shams Resort )
• Wahiba Sands – 1 night (stay at Desert Retreat Camp )
• Ras Al Hadd – 1 night (stay at Ras Al Hadd Guesthouse )
• Sur – 1 night (stay at Sur Hotel )
• Muscat – 1 night (stay at Beach Bay Hotel )

Our Oman road trip was for 10 nights and we drove 1378km around the north of the country.

Distances aren’t long on this route and we had quite a lot of down time, so you could easily do this itinerary in seven days.

For one week in Oman, reduce the first stay in Muscat to one night, the Nizwa/Jebel Shams area to three nights, and skip the night in Sur (you can visit on the way from Ras Al Hadd to Muscat).

When you are planning your Oman travel itinerary, remember that as Oman is a Muslim country the weekend is on a Friday and Saturday and many places close on Fridays.

Note: The distances of each leg of our journey are taken from Google Maps (which we used for navigation) and the times are the actual time it took us. I’ve noted if we stopped for a break.

Our flight arrived at Muscat International Airport at 7 pm and we picked up our rental car and drove 30 minutes to the Mutrah area.

The next day we got an early start (arriving at 8.30 am) for Muscat’s best attraction—the Sultan Qaboos Grand Mosque .

This stunning, huge, modern mosque is open to visitors from 8.30am to 11 am every day except Friday and is free.

There is a strict dress code—women must cover up completely with long sleeves, long trousers or floor-length skirt, and a headscarf (I used my sarong). Abayas are available to rent if you don’t have anything suitable to wear.

Men should wear long trousers and cover their shoulders.

Don’t miss the mosque—it is absolutely gorgeous, both the serene grounds and the extravagantly decorated main prayer hall. I recommend arriving early to enjoy it before the tour groups arrive.

In the afternoon we rested back at our hotel before heading out at 3 pm for the 30-minute walk to Mutrah Corniche .

This was my favourite part of Muscat (and one of the few walkable areas) with a lovely promenade with white buildings backed by rugged mountains overlooking the sea. It’s especially pleasant at sunset.

The nearby Mutrah Souq reopens after the afternoon break at 5 pm. The crowded alleyways are touristy but a good place for souvenir shopping.

Where to Stay in Muscat

We stayed at Mutrah Hotel between the Little India area of Ruwi and the Mutrah Corniche.

The decor was dated but our room was huge with a seating area, ensuite, fridge, air con, OK WiFi, and room service.

We had a view of the mountains behind the hotel and there is a SPAR supermarket across the road as well as a few cheap Indian restaurants nearby.

It was one of the cheapest hotels we found in Muscat and we were happy with our choice.

Where to Eat in Muscat

We had lunch at Welcome Restaurant , a small, simple, vegetarian Indian restaurant near our hotel.

At lunch they only had thalis but it was very good with an array of curries, puffy puri bread, and a sweet for only 2.5 OMR (£5) for both of us including water.

We had dinner near the Mutrah Souq at Bait Al Luban , an upmarket restaurant serving traditional Omani cuisine.

It’s named after frankincense (which is grown in Oman) and the pungent scent smokes through the restaurant. They even add it to the water.

We sat on cushions and ordered from the decent vegetarian section—our Omani vegetable curry and fava beans in tomato sauce with date flatbread were good. Afterwards they brought us a big bowl of delicious Omani dates.

Bait Al Luban is more expensive than most restaurants in Oman, but it’s not unreasonable and it’s worth it for a special meal as there aren’t many destination restaurants in Oman.

Distance: 176km Time: 2 hours

The drive to Nizwa was easy on good quality highways through the desert surrounded by barren mountains, passing the occasional oasis town.

We continued past Nizwa to the 17th-century Jabrin Fort (also known as Jabreen or Jibreen Castle), one of the best forts to visit in Oman.

Entrance was only 500 baisa (£1) and it wasn’t very busy. There’s a labyrinth of rooms to explore and you can enjoy views of the date palms and mountains from the battlements.

You could also visit nearby Bahla Fort , but we were exhausted so headed back to Nizwa to check in to our hotel.

Nizwa isn’t a particularly attractive town. It’s very spread out and the outskirts (where the hotels are) are full of strip malls and fast food chains.

The fort and souq area are worth a visit though and we went in the late afternoon.

The Nizwa Fort is open from 8 am to 8 pm (except on Fridays when it’s 8–11.30am and 1.30–8pm) and the souq opens in the mornings and from 5 pm to 8 pm.

We have mixed feelings about Nizwa Fort. It is beautiful, especially the massive circular tower which you can climb for views of the city and mountains beyond, but it now costs 10 times what it used to—5 OMR (£10/ $13).

For that price you would expect it to be better maintained, but the lights in the exhibition area flashed annoyingly.

It probably didn’t help that we’re not super into forts, so if you aren’t on a tight budget or are a history buff then you should visit.

On our second morning in Nizwa we visited Jebel Akhdar (Green Mountain) . The base of the mountain is in Birkat al Mawz , a 15-minute drive from our hotel.

When you reach the town follow signs to turn left to Al Jabal Al Akhdar . You drive up the mountain until you arrive at a car park and police checkpoint—it’s 4WD only beyond this point.

As we were in a 2WD we parked and a young guy called Mohammed immediately approached us in his shiny 4WD and offered to drive us up for a tour for 35 OMR (£73/ $91).

On the way up we stopped at various viewpoints for spectacular views of the rugged mountains and villages that cling to its sides.

At the Saiq Plateau you realise why it got its name as the green refers to the terraces of fruit trees and roses that are grown in the villages. Spring is a better time to visit to see everything in bloom.

We spent about two and a half hours enjoying the views and taking short walks in the cool air (take layers!).

An interesting addition would be the two-hour hike between the villages of Al Aqr and Al Ayn .

We were back at our hotel by lunchtime, so you could skip the extra night in Nizwa and continue to Jebel Shams .

Where to Stay in Nizwa

Most of the hotels in Nizwa are quite far from the centre. Al Karam Hotel Apartment was one of the cheapest places we found but was surprisingly good, despite its random location off a highway surrounded by desert.

Our one-bedroom apartment was spacious, clean and comfortable, if rather characterless.

We liked having a separate living room with couch and used the small kitchen to self-cater. WiFi was pretty good. A breakfast buffet is included in the price.

Where to Eat in Nizwa

There didn’t seem to be anywhere particularly good to eat in Nizwa, so we self-catered at the amazing, huge Lulu Hypermarket .

It really has everything you could possibly need including an excellent prepared food section where we stocked up on samosas, dahl, curries, rice, salads, hummus, and bread.

They even had all of our favourite British chocolates and it’s a good place to buy inexpensive dates.

The Nizwa Fort Coffee Shop between the fort and the souq looked like a pretty good option for coffee, juice, and snacks.

Distance: 108km Time: 2 hours 20 minutes via Misfat

You could visit Jebel Shams as a day trip from Nizwa but we decided to spend a few nights up there to enjoy the views and tranquility.

On the way we stopped at Misfat al Abryeen , one of Oman’s oldest and most picturesque villages.

From the modern side of the village there are fantastic views of the old village clinging to the mountainside and surrounded by lush date palms—walking through the oasis is a highlight.

Misfat is an interesting place but we felt a little intrusive exploring the village itself. It’s a tiny, traditional place of crumbling mud houses and has become popular with visitors.

There are signs everywhere reminding guests to cover their shoulders and knees and warning people away from walking down private alleyways.

It might be more rewarding to stay overnight at Misfah Old House guesthouse , although it’s expensive for what you get. 

We continued to the top of Jebel Shams. A 4WD is recommended but we heard it was possible to make it up in a 2WD.

And we did, but I do not recommend it for nervous drivers or if you have no off-roading experience.

There’s a 7km section of steep, rocky dirt track, some parts sandy and rutted, and if we had got stuck we would have been in trouble.

At the top, just before Jebel Shams Resort , there’s a viewpoint where you can see down into the dizzying depths of what’s known as Oman’s Grand Canyon and admire the long hair goats posing on the ledge.

We spent the afternoon relaxing at our hotel and got an early start the next day for the highlight of Jebel Shams— the Balcony Walk .

The hike (a section of the W6) starts 10 minutes further down the road (another off road section) from the tiny hamlet of Khateem .

Just follow the red/yellow/white splotches of paint on the rocks to follow the trail along the edge of the canyon.

It’s an out and back hike and the views are amazing straight away so you could just walk a little way.

It’s worth continuing to the abandoned village of As Sab where tiny stone and mud houses perch precariously on the edge of the canyon under a ledge of rock. It’s unbelievable that people lived in such a harsh (if beautiful) environment.

The entire hike (3.5km each way) took us 2.5 hours including a break at As Sab.

We were the first people to arrive at 8.20 am and had most of the hike to ourselves and avoided the worst of the heat. We spent the rest of the day relaxing at our hotel.

Where to Stay and Eat in Jebel Shams

Unless you want to wild camp, there are only two places to stay at the top of Jebel Shams. We stayed at the nicest of the two— Jebel Shams Resort .

It’s not much of a resort and it’s quite expensive, but we enjoyed our tranquil stay.

Our Sunset Chalet had twin beds (unfortunately they all do), a couch, table and chairs on the terrace, a fridge, and a small heater (needed on the cold nights).

There is supposed to be WiFi at reception, but it didn’t work for us and we didn’t have mobile signal either.

Breakfast and dinner are included in the price—the food was decent and had vegetarian options.

I recommend bringing bottled water, snacks and lunch as the small snack bar is only open 12–3pm and has a limited menu. There are no other restaurants or shops on the mountain.

The nearby Sama Heights Resort is cheaper if you stay in one of their furnished tents. 

Distance: 253km Time: 4 hours 45 minutes including detour to Ibra and lunch break

Wahiba Sands is what you picture when you think of the desert—rolling sand dunes, camels, and Bedouin tents.

To explore the area it’s best to stay the night in one of the desert camps.

We wanted somewhere simple (we didn’t need A/C and a pool), quiet (some are close to noisy 4WD trails), away from towns with minimal light pollution, and near a large sand dune that we could climb.

Many camps offer camel rides and 4WD dune-bashing drives, but we were content to explore on foot.

The Desert Retreat Camp met all of our requirements and had the benefit of feeling remote but being only a 20-minute drive into the desert.

Most camps require a 4WD to reach them or you can pay a high price for a transfer from the town of Al Wasil.

We were told this camp was accessible in our small SUV. And it was, but it was nerve-wracking driving through the sand.

The meeting point is at 3 pm at the Desert Retreat Camp office at the Al Maha petrol station in Al Wasil (there’s a shop and restaurant there too).

We paid in cash (make sure you stock up in advance) then followed the guide’s dust cloud as he sped through the sand.

The Desert Retreat Camp is the last camp in this part of the desert and there’s nothing else around except for a few buildings where locals store feed for the goats that wander nearby.

As there was only one other guest that night, and there’s no WiFi or 3G, it was wonderfully peaceful.

We were greeted with Omani coffee in tiny cups and the best dates we’d eaten so far.

The Bedouin goat hair tents are laid out in a double ring at the foot of a dune, all with their own private but separate bathroom.

Many camps don’t have electricity but we had a light and a dodgy looking power point.

Our tent was furnished simply with two twin beds pushed together, a table and a coat rack. It was all we needed as we were here to enjoy the setting.

It’s only a 15-minute walk up to the top of the dune, but it’s a tough climb as you sink into the sand constantly. It’s worth it for the views of rolling dunes, especially in the glowing light at sunset and sunrise.

Dinner and breakfast are included in the price and were good—vegetable curries, homemade flatbread, rice, salad, and hummus followed by delicious Omani halva.

We spent the night drinking tea around the campfire then gazing at the explosion of stars.

Distance: 213km Time: 4 hours via Wadi Bani Khalid

From Wahiba Sands we headed towards the coast with a stop at one of Oman’s most popular wadis, Wadi Bani Khalid .

It’s a stunning drive over the mountains off Highway 23 through small villages—just keep following signs to the cave/water pools.

From the car park it’s a five-minute walk to the clear green pools surrounded by date palms and rocky mountains.

It has been developed with a few bridges, seating areas, and a restaurant, but it doesn’t detract from its beauty.

We spent a blissful few hours swimming in the cool water, getting foot massages from the nibbling fish, and sunbathing on the rocks. It was one of our favourite places in Oman.

We had the buffet lunch (4 OMR) at the restaurant but you are better off bringing a picnic if you can.

Read our tips for visiting Wadi Bani Khalid . 

The desert stretches all the way to the sea at Ras Al Hadd . It’s a bleak little town, but it does have a stretch of wild, empty beach with golden sand and turquoise waves.

It’s better for walking than for sunbathing or swimming, though. We chose to stay here to be close to the Ras Al Jinz Turtle Reserve that’s a 15 minute drive away—it’s much cheaper than staying at the reserve .

Where to Stay in Ras Al Hadd

Ras Al Hadd Guesthouse is the cheapest place we found in the area at just 18 OMR (£37/ $47). It’s difficult to find as although it’s marked correctly on Google Maps it’s unclear how to get there.

Follow the guesthouse sign off the main road and drive off-road over a wide section of dirt then onto an area of broken up tarmac that feels like an airport runway.

Make sure you look up photos of the hotel in advance so you can head towards the large green and white building.

Despite the odd location, the guesthouse was fine. As usual, the rooms were characterless but functional with a fridge, TV, A/C, balcony with sea view, and unreliable but decent when working WiFi.

The staff was friendly. Note it’s cash only and there’s no ATM nearby.

Where to Eat in Ras Al Hadd

There’s a strip of simple coffee shops (Omani style restaurants) on the main road. We chose the first coffee shop on the left past the Ras Al Hadd Motel coming from our hotel.

As often happened in Oman they didn’t stick to the menu but gave us a choice of veg or non-veg, rice or paratha bread.

We ended up with a surprisingly decent Indian thali with dahl and a few vegetable curries. It only cost 2 OMR (£4/ $5) for both of us including soft drinks.

Distance: 42km Time: 40 minutes

We woke up early for the 5 am tour (you can also do one at 9 pm) at the Ras Al Jinz Turtle Reserve , which we had booked a few weeks in advance by email (reservations are recommended).

They send a guide out onto the beach first to locate the turtles, but sadly they couldn’t find any so we returned to our hotel disappointed.

At least we weren’t charged the 7 OMR (£15/ $18) fee. Winter isn’t the best time to see the turtles (high season is July to October), but you do have a chance of seeing a few year round.

After a nap and wander on the beach, we headed to the nearby town of Sur stopping at the fishing village of Al Ayjah for lunch and a stroll. You can also visit the dhow boat-building yard nearby.

There wasn’t much to do in the afternoon, but at sunset we went for a stroll on the beach where hundreds of local men were playing huge football games. We didn’t see a single local woman walking anywhere in Sur.

In retrospect, we could have skipped the night in Sur and continued to Muscat.

Where to Stay in Sur

Sur Hotel was the most basic place we stayed in Oman. Our small room had rather depressing decor, but it had all the usual facilities and was very cheap at 11.7 OMR (£24/ $30). It was fine for one night.

Where to Eat in Sur

Sahari has good Arabic mezze with a view of the lagoon between Al Ayjah and Sur. Service was slow and it’s more expensive than most places (you’re paying for the setting).

Our Indian dinner at Sea Sur restaurant next to our hotel was decent.

Distance: 382km Time: 2 hours 20 minutes

On our way from Sur to Muscat we stopped at Wadi Shab , one of Oman’s best attractions.

It involves a 5.6km hike in a stunning canyon then a swim through a series of pools to reach a small cave which contains a waterfall.

We arrived at 8.20am and were the first people there, but this resulted in us getting terribly lost as we didn’t realise we’d reached the pools and kept going past them.

Make sure you don’t make the same mistake we did. If you arrive a bit later you’ll see people swimming there and it’ll be obvious.

If you are the first people, just make sure you stick to the low path—don’t climb up on the higher path as it means you’ve gone too far.

You have to swim/walk/swim for 10 minutes down the pools until you get to a tiny gap between two massive boulders.

You swim through that (with just enough space for your head out of the water) to get to the cave which has a small waterfall. You can’t see the cave from the outside.

Despite our issues, I do recommend an early start, as it gets very busy by late morning. It’s a beautiful place and well worth a visit.

If you have the time, you could also stop at nearby Wadi Tiwi and the Bimmah Sinkhole .

In Muscat we stayed in a different area, the diplomatic enclave of Qurum next to the city’s best public beach.

It felt like a different world from Mutrah with fancy villas, foreigners wearing skimpy clothes, a scarcity of cheap shops and restaurants, and more Western chains like Costa Coffee and Pizza Express.

We could have paid 5 OMR (£10/ $13) to use the pool of the extravagant Grand Hyatt hotel next door, but late in the afternoon it wasn’t worth it, especially as we would have spent a fortune on food and drinks.

We went for a walk along the beach instead.

Beach Bay Hotel was one of the nicest hotels we stayed in Oman, although it’s comfortable rather than special, and a little dated.

It’s only a few minutes walk from the beach and the breakfast was my favourite in Oman with a large selection of mezze.

It’s significantly more expensive than Mutrah Hotel where we stayed previously, but it’s one of the best value in this area. It’s convenient for the Grand Mosque and airport.

We walked about 30 minutes along the beach to the Oasis by the Sea shopping centre where there are a number of restaurants.

Our Oman road trip ended in Muscat with a flight out the next morning.

Everyone should dress modestly in Oman. For men this means t-shirts and long trousers (although you can get away with knee-length shorts).

Women need to cover their shoulders and knees, and outside Muscat I usually covered my arms and legs.

My usual outfit was linen trousers or jeans plus a long sleeve shirt. Or I’d wear a t-shirt and take a cardigan to cover up with when I got out of the car.

You only need to cover your hair at the Grand Mosque—I used a sarong.

For swimming in wadis, I wore capri leggings and a baggy t-shirt of Simon’s.

For hiking the Balcony Walk, I also wore a t-shirt and capris plus a few long-sleeve layers for the cold morning start.

A few other things to pack for Oman:

• Universal travel plug adapter –   Oman uses the UK three pin plug.
• Torch (flashlight) – For desert camps.
• Bradt Oman Guidebook – A comprehensive guide. We used the Kindle edition.
• Arabian Sands book – There aren’t many books set in Oman but this is a good one. It’s set in the late 1940s when Englishman Wilfred Thesiger explores deep into the deserts of Oman and surrounding countries. He was one of the last people to document the Bedu way of life before oil was discovered and most Bedu gave up their nomad ways for the towns—a decision you’ll understand when you read how harsh life in the desert was.

As one of the safest countries to visit in the Middle East we hope this post has given you plenty of ideas to put together your own Oman itinerary for your own adventures in the mountains and desert!

• What to Expect When Visiting Oman
• 11 Beautiful Places to Visit in Oman
• Visiting Wadi Bani Khalid: Oman’s Desert Oasis

If you enjoyed this post, pin it!

35 Comments

Thanks so much for your post. We originally planned to visit Oman on March 6, 2020 — but alas, all plans were quashed by Covid. We now planning our trip for March 2023. Hopefully we’ll be able to use our credits on OMAN Air …. We will follow your route and post our experience at partnersinadventure.com We’ll be sure to reference you! Again, your tips are much appreciated.

Reply ↓

Thank you very much for your detailed itinerary with many useful tips. I’ve alredy booked open jaw tickets Europe- Muscat and Salalah-Europe for FEB 2023 and I am pretty sure I will follow your itinerary fairly closely.

Enjoy Oman!

Thanks so much for this. Getting ready for my Oman trip starting at the end of December and have feverishly taken notes based on your post.

Have a brilliant time in Oman, Lisa!

>>We arrived at 8.20 am and were the first people there, but this resulted in us getting terribly lost. We’ll be writing about this soon so >>you don’t make the same mistake!

So what’s the mistake not to make at Wadi Shab?

Oh yes, I never got around to writing about this! Basically we didn’t realise we’d reached the pools (we expected to see a cave) and kept going past them and then back again and trying out different routes.

It turned out you have to swim/walk/swim for 10 mins down the pools until you get to a tiny gap between two massive boulders and swim through that (just enough space for your head out of the water) to get to the cave which has a small waterfall. You can’t see the cave from the outside.

If you arrive a bit later you’ll see people swimming there and it’ll be obvious. If you are the first people just make sure you stick to the low path – don’t climb up on the higher path as it means you’ve gone too far.

Here are some good directions (just note what the swimming pool looks like so you don’t miss it): https://www.zigzagonearth.com/wadi-shab-oman/

We plan a road trip to Oman, but will drive from Dubai. Very useful info presented, will use this as a guide through. We will mostly make the same route as you did only that we begin with Jebel Shams and end up in Muscat.

Sounds like a good plan. Enjoy!

A lovely blog to read and most useful. Am planning a trip to Oman, but in late spring spring/early summer….! Much enjoyed reading it. Thank you for sharing

Enjoy your trip to Oman, Adrian!

Thanks for another hugely useful post. Unlike other travel bloggers who seem only to want to brag about where they have been, your posts are always genuinely useful. We will be using this for a trip next Spring. Thank you¬

Aw, thanks very much Liz! Enjoy Oman!

We’ve just finished up a trip to Oman and your blog post was an amazing help to plan our itinerary! Thanks for sharing!!

I’m so glad to hear it helped, Kristen!

Thank you for this detailed information pack. It is very helpful.

I’m glad you found it helpful. Enjoy Oman!

Thank you for this! I’m going to use your exact itinerary.

Great! Let us know how it works out for you!

This is a great help. I’m wondering if you ever spent any significant time just hanging out at a beach there. I love the idea of exploring the desert etc, but my kids would also like some time to simply swim and sun.

We didn’t spend much time on the beach -just some long walks on the beach at Ras Al Hadd (which was lovely but didn’t really feel like a swimming/sunbathing beach) and at Qurum Beach in Muscat (which has a lot more foreigners and locals hanging out on). It would be easy to add a few beach days in Muscat at the beginning or end of your stay as many people do.

Just remember that women have to cover up on public beaches, so staying at a beach resort might be a better option if you’re travelling with a wife or older daughter (although Muscat seemed more liberal in that respect).

Thanks… this is a big help. We’ll let you know how it goes…

Thank you for this amazing summary! We are planning to go in November and we will use this as a base for planning.

Enjoy Oman, Nora! November is a great month to visit.

Great post! We are going to Oman in October 16 days. It’s perfect . I think that the post can help us a lot. Thanks

Excellent! Have a brilliant trip Marta!

I love your itinerary! I am planning to try and visit Oman this summer around June. How feasible is the road trip from Muscat to Salalah via road? Also how safe is it to wilderness camp, as I think this may be the best option for me since I will be doing this trip solo?

I’ve heard that the road trip to Salalah is definitely possible but it’s very long and boring, so most people fly to the region.

Wild camping is very safe (Oman is incredibly safe) so you should be fine. It’s definitely the cheapest way to travel the country.

Great post, guys! Very thorough post about Oman, one of my favourite countries. By the way, I love the blog’s new layout!

Used you Oman itinerary for a trip just 2 weeks ago. Your post was an excellent source of information, had a great time. That quiet fishing beach was the highlight of the trip. Thanks again

I’m so glad you enjoyed your trip John.

Great writeup! I definitely want to do this someday and will follow your tips!

As a follow up comment/question, I like how you guys drive on a lot of your trips (I was very inspired by the Namibia one), and was wondering if someday, when you’re looking for article ideas, if you could post which countries have been the easiest to drive in?

2017 was the definite year of the road trip for us! I will add doing a post about the best road trips to my list – thanks for the idea! Other than the US, South Africa was probably the easiest one we’ve done in terms of the road conditions although distances were pretty long and you have to be a little careful about safety (keeping doors locked, not driving at night).

Leave a Reply Cancel reply

Required fields are marked *. Your email address will not be published. By clicking the Submit button, you give consent for us to store your information for the purposes of displaying your comment and you accept the terms of our Privacy Policy .

This site uses Akismet to reduce spam. Learn how your comment data is processed .

Créer mon voyage personnalisé

Très simple ! Indiquez simplement votre mail pour vous inscrire ou vous connecter

Votre adresse email est collectée par Partir.com pour vous permettre de créer votre voyage et vous partager nos offres et actualités. Vous pouvez vous désabonner à tout moment en utilisant le lien présent dans nos communications. Pour en savoir plus sur le traitement de vos données et sur vos droits, consultez notre Politique de confidentialité.

Comment réussir votre voyage à Oman ?

Notre méthode pour réussir votre voyage.

Voyagez au mois de décembre pour profiter des meilleures températures et échapper à la grisaille européenne.

1 Partez à la meilleure période

Pour être sûr de partir à la bonne période, consultez nos conseils et historiques météo avec pour chaque mois de l’année les températures, l’ensoleillement et la pluviométrie. Climat et météo à Oman

Réservez vos billets d'avion plusieurs mois en avance pour obtenir les meilleurs prix !

2 Réservez vos vols intelligemment

Quelle est la meilleure période pour réserver son vol ? Comment payer moins cher son billet d’avion ? Comment optimiser son temps de trajet ? L’équipe de Partir.com a mené son enquête pour vous aider à trouver le vol idéal.

AVANT DE COMPARER VOS VOLS

Gardez bien ces 3 tarifs en mémoire. Ils vous donnent en effet de précieux repères pour voyager au meilleur prix.

3 Choisissez la bonne formule

Comparez les différentes formules, 4 sélectionnez les lieux à visiter.

Quand on évoque Oman, on pense immédiatement à ses réserves pétrolières impressionnantes. Et pourtant, l’or noir n’est pas le seul centre d’intérêt dans ce petit pays longtemps inconnu des voyageurs. En effet, personne ne peut rester indifférent face au contraste de l’impressionnant azur de l’océan Indien, du vert luxuriant de palmeraies irriguées par les wadis, des dunes rouges et blondes du désert illuminées par l'étincelant soleil d'Arabie, et toujours habitées par les Bédouins. Dans ce pays du bout du monde, l’évasion et le dépaysement sont assurés.

Carte des lieux d'intérêt

Vous immerger avant le grand voyage

5 imprégnez-vous des expériences vécues, l'avis de ariane.

Oman est un pays tout simplement somptueux. Après de nombreux voyages au Moyen-Orient, je dois dire que le sultanat est à ce jour ma destination préférée. La diversité des paysages , l’ authenticité des traditions et la qualité de l’accueil m’ont marquée tout au long du voyage. Oman est un pays où on se sent en sécurité, y compris en tant que femme. Les Omanais traitent les voyageurs et voyageuses avec beaucoup de respect et de sens de l’hospitalité. Toutefois, je conseillerais de faire attention aux dangers liés au milieu physique : Oman reste une terre d’aventure, et les risques ne viennent pas des gens, mais de la nature elle-même. D’immenses déserts de sable brûlant, des wadis qu’une pluie soudaine peut inonder, des routes de montagne abruptes… un voyageur imprudent aurait vite fait de se perdre ou de se mettre en danger. C’est pourquoi je conseille de préparer attentivement son voyage, de ne pas s’aventurer dans une zone désertique sans préparation adéquate (ou sans eau !), et de respecter les interdictions imposées par les autorités, comme la restriction d’accès de certaines routes aux seuls véhicules tout-terrain. Avec un tout petit peu de prudence et de bon sens, ce voyage à Oman pourrait bien être un des plus beaux de votre vie !

L'avis de la rédaction

❤️  on adore.

• L’immensité des zones désertiques
• La richesse des saveurs locales
• Le patrimoine architectural d’origine orientale
• Les cultures d’influence indienne
• Les villes portuaires de Sour et de Mirbat

🙁  Nous aimons un peu moins

• La forte chaleur dans le pays notamment en été

6 Évitez les pièges et suivre les conseils de la rédaction

Lors de votre visite en Oman, une halte dans la capitale, Mascate, s’impose. Son vieux port et son palais du sultan, le fort de Mutra, le Musée d'Oman, le Musée national de Ruwi ainsi que le musée des Forces armées de Bait al-Falaj méritent le détour. Direction ensuite Salala avec ses sites archéologiques saisissants, dont celui des ruines d'Al-Balid. A Nizwa, ne ratez pas le fort de ibn Saif ainsi que son souk riche en couleurs. Pour garder un souvenir inoubliable du pays, visitez aussi la côte de Batina située dans le nord d’Oman, avec le fort intemporel de Barka, la ville historique de Sohar, les sources d’A'Thorwara de Nakal. A Sur, le patrimoine architectural (chantier naval et forts médiévaux) fait un avec l’héritage naturel (des plages remarquables).

A Oman, toutes vos activités en plein air peuvent être pratiquées. Entre les courses de chameaux et la traversée du désert en 4x4, le patinage sur glace et la plongée sous-marine, la randonnée et la hash house harriers, tout est permis. Vous pouvez également partir à la conquête des montagnes et des canyons à travers des épreuves relativement difficiles d’escalade et de spéléologie. Si vous êtes passionné de plongée, découvrez les fonds marins de la mer d’Arabie, avec des sites à ne pas rater du côté des îles de Daymanyiat, refuge des barracudas, des platax, des raies et diverses tortues. Ces dernières sont encore plus nombreuses sur les plages de Ras el Jinz durant la période de ponte. Lors de vos sorties en mer, offrez-vous un rendez-vous privilégié avec les baleines et les dauphins sur un dhow, depuis Sour ou Mascate. Enfin, ne ratez aucune occasion pour explorer le désert rouge de Wahiba en 4x4.

Vous découvrirez en Oman plusieurs articles d’artisanat notamment des objets en cuivre, de la poterie, bijoux divers, du parfum, de l’encens, sans oublier le kandjar qui n’est rien d’autre qu’un poignard en argent.

Essayez la cuisine d’Oman fortement inspirée de la gastronomie indienne. Parmi les recettes à ne pas rater figurent les plats de viandes et de poissons cuits façon tandoori, masala ou tikka. Le biryani, plat national, ainsi que le kabsa et le makbous sont incontournables dans les menus des restaurants. Commandez également le chawarma, les mezze et le falafel, qui sont des spécialités libanaises à essayer à tout prix. Dans les rues d’Oman, vous retrouverez des restaurants asiatiques, mais également des pizzerias à l’italienne.

7 Checkez les formalités administratives et sanitaires

Et vous, que pensez-vous de oman .

Oman Itinerary: The Ultimate 7 to 10 Day Guide (2023)

This post may contain compensated links. Find more info in our disclosure policy

Having spent an amazing two weeks exploring the cities, mountains, desert and coastline of Oman we’ve put together our recommended Oman itinerary. From historic Muscat to the beauty of Jebel Shams to the natural wonders of the Ras Al Jinz turtle reserve, Wadi Shab and the Bimmah Sinkhole, Oman is breathtaking and one of our favorite places to visit in the Middle East.  For those of you planning your own Oman itinerary, we wanted to share our guide to Oman including the best things to do and what to see. Enjoy!

  Oman Itinerary and Route

With its excellent roads and good driving standards, Oman is the perfect country for a road trip. We followed a circular route starting and ending in Muscat, Oman’s capital city and the point of arrival and departure for most Oman travellers.

The Route: Muscat – Nizwa – Jebel Akhdar  – Wahiba Sands – Sur – Jas al Rinz – Muscat

Click here for an interactive Google map with all the sights marked

How long to spend in Oman

We recommend budgeting 10 nights to explore Oman at a leisurely pace. This will allow you enough time to visit all the major sights, from Muscat to the Al Hajdar mountains and the many beautiful Wadis as well as the unmissable Wahiba Sands desert. Our route can be completed in as little as 7 days, however, a one week visit won’t leave much space for downtime.

Oman itinerary tip:  Depending on your style of travel you can either base yourself in Muscat for 5 to 6 nights of this itinerary and visit many of the places via day trips, or you can move around the country, spending a few nights in each area.

How to get around Oman

Most visitors to Oman either pick up a rental car and self-drive or use taxis/private drivers to explore the country.

Renting a car in Oman

Oman is by far one of the easiest countries we’ve rented and driven a car in and we highly recommend renting a car in Oman if you are comfortable driving. The roads are high-quality, driving standards are generally good and fuel is extremely cheap (compared to the UK and Ireland anyway!).

We rented a 4×4. While this option is a little more expensive, having a 4×4 allows for a more comfortable journey and it gives more options for exploring. In particular, a 4×4 is recommended to access Wahiba Sands (regular cars can get stuck in the sand) and for the Jebel Akbar and Jebel Shams mountain ranges.

We’re huge fans of road trips and have driven rental cars in almost 50 countries so we have a lot of experience renting cars in foreign countries. Oman is one of our favourite countries where we have rented a car. Book your car now with RentalCars.com ,  where you will find the best rental car prices

Click here for the best rental car prices!

Best time to visit Oman

Depending on your tolerance to high temperatures, you may want to plan your visit to coincide with the cooler months! During the summer, temperatures can reach almost 50°C making sightseeing very difficult

Oman itinerary tip:  We visited Oman at the end of October and the temperatures were a pleasant 30°C during the day. We planned our hikes and outdoor activities for first thing in the morning and relaxed in the afternoons during the peak midday temperatures.

Sim Card and Internet

As with most countries, having mobile data during a trip is invaluable for navigation and research. There are lots of options on arrival at Muscat Airport – we picked up an Omantel data only sim card and had good reception throughout most of the country.

Oman Itinerary tip:  Google maps turn by turn navigation doesn’t work in Oman. We used Waze, a great alternative and very useful for avoiding traffic delays in Muscat.

Daily Oman Itinerary

We’ve outlined our day to day Oman itinerary as a starting point for planning your own Oman experience.

Days 1 to 3: Muscat

Oman’s capital city really surprised us with the wide variety of things to see and do. After arriving at Muscat Airport we recommend spending the next two nights in Oman. This will allow you to see the main sights and to enjoy everything that this beautiful coastal city has to offer.

Where to Stay in Muscat

There are many great accommodation options in Muscat and, although the focus is on high-end luxury, it’s possible to find hotels to fit any budget.

• Sheraton Muscat – we stayed in the Sheraton Muscat and rate it very highly. The hotel is located between Old and New Muscat, with most sights reachable in under 15 minutes by car  – check prices now!
• Kempinski Hotel Muscat –  located close to the airport and along Muscat’s beautiful coastline, the Kempinski is a relatively recent addition to the Muscat hotel scene– check prices now!
• Park Inn by Radisson –  within walking distance of the many shops of Avenues Mall and Muscat Grand Mall, the Park Inn is clean and comfortable with a great rooftop pool –  check prices now!            

Click here for the best Muscat hotel prices

Day 1: Explore Muscat

Day 1 is an introduction to some of Muscat, and Oman’s, finest sights with visits to the Sultan Qaboos Grand Mosque, the Muttrah Corniche and the Muttrah Souk.

Sultan Qaboos Grand Mosque

The stunning Sultan Qaboos Grand Mosque is a Muscat highlight, so much so that we visited it twice! The magnificent mosque was completed in 2001 and welcomes up to 20,000 people during prayers.

The grounds of the mosque are stunning but it is the interior of that steals the show. The main prayer hall has a huge intricate prayer rug and a beautiful chandelier, the largest in the world, with ornate detailing on the roof. Plan at least 1 to 2 hours to really enjoy the mosque and visit early to avoid the crowds.

Oman Itinerary tip: Non Muslims are allowed to enter the mosque from Saturday to Thursday between the hours of 8am and 11am. Due to this the mosque tends to get extremely busy from 9.30am to 11.00am with tourists.

What to wear when visiting the Sultan Qaboos Grand Mosque

The Sultan Qaboos Grand Mosque has a strict dress code which needs to be adhered to. Women must have their hair covered and clothes must reach the wrist and ankle. They were very strict about enforcing this and headscarves and robes are available to rent at the entrance. Men must also cover their arms and legs .

Oman Itinerary tip:  visitor attire is checked upon entry. If your chosen outfit is not acceptable you will be directed to the entrance and avised to rent suitable clothing before being allowed to entry.

After the early morning start, relax at your hotel during the hottest part of the day. The temperatures can get very hot so try to aim to be indoors or near a swimming pool/your hotel.

Muttrah Corniche and Muttrah Souk

As the temperatures cool in the afternoon, take a stroll along the Muttrah Corniche promenade. The corniche is beautiful in the late afternoon and is often crowded with locals and tourists enjoying the cooler evening air. Make sure to look out for the magnificent incense burner monument on the hill by the sea.

After a stroll along the corniche, prepare to haggle at the Mutrah Souk, one of the oldest Arabian markets in the world. It’s easy to get lost in the narrow streets of the ancient souk, where everything from gold and incense to fridge magnets are sold.    

Day 2: Day trip to Wadi Shab

Oman’s most famous wadi, Wadi Shab, is simply incredible and a highlight of any Oman itinerary. The beautiful turquoise pools, waterfalls and cave finale are more than enough reward for the hike into the canyon!

Oman itinerary tip: Wadi Shab is an easy day trip from Muscat or, if you prefer, the Sama Wadi Shab Resort is a good option close by – check prices here!

Wadi Shab: What you need to know

• The entrance to Wadi Shab is a 2-hour drive south along the coast from Muscat and located just off the motorway. There is a dedicated car park at the entrance.
• Depending on water levels, visitors take a short boat ride (2 OMR return) across the Wadi to the start of the hike.
• Aim to arrive at the entrance to Wadi Shab as early as possible as this will allow you to complete the hike in the cooler morning temperatures when there is more shade.
• The wadi involves a relatively strenuous hike which takes around one hour from the car park. We only recommend participating if you are in reasonably good fitness.
• It is recommended that you are a strong swimmer and can swim at least 100metres if you wish to swim through the cave at Wadi Shab. Please do not put yourself or others in danger.
• Plan an early morning start from Muscat to Wadi Shab. It’s worth dedicating a day to this trip as it’s an early start, a very long hike and in the heat, you will be very tired.
• There are limited facilities and cell phone coverage in the Wadi, so make sure to pack lots of water and some food. Water shoes and a wet-bag for your electronics are also must-haves as you will get wet!

Oman iItinerary tip:  Wadi Shab is a very popular place for tourist and locals at weekends so we recommend visiting on a weekday. There can be significant crowds at weekends so the experience can be more enjoyable if you can avoid these peak times

Relax at your hotel that evening.

Day 3: Old Muscat and the beach

This is a more relaxed day with time to explore Old Muscat and the iconic Al Alam Palace in the morning followed by a visit the Shatti Al Qurum beach in the afternoon/evening. If you enjoy a sunset stroll, wrap up day 3 with a visit to a local favourite, Yitti beach.

Located on a bay at the end of the Muttrah Corniche, Old Muscat is the original historic centre of Muscat and home to the ceremonial palace of the Sultan Qaboos of Oman. The sleepy atmosphere of Old Muscat is interrupted only by the occasional group of tourists meandering through the streets. Highlights include three 16 th Century forts built by the Portuguese, the old watchtower and the National Museum of Oman.

Shatti Al Qurum Beach

It’s time to experience the Oman beach scene with a visit to one of the best beaches in Oman, Shatti Al Qurum. The lively beach is located in the centre of Muscat. It’s a really popular spot with locals and a great place to relax in the evening.

Sunset at Yitti Beach

We highly recommend an early evening trip to the scenic Yitti Beach which is around 25 minutes south of Muscat. The drive along the coastal road is beautiful and watching the sunset at Yitti beach is popular with locals and tourists alike.

Oman itinerary tip: Yitti is a popular camping and party spot at the weekends so we prefer to visit during the week.

Days 4 and 5: Nizwa and the Mountains

After a few days of exploring Muscat, we head inland to the mountainous region of Oman, an area that is jam-packed beautiful sights. Two nights is optimal to see most of the major sights while also allowing some down time to relax and enjoy the surroundings. We recommend spending one night in Nizwa and a second in the stunning Al Hajar mountains.

Where to Stay in Nizwa

• Nizwa Hotel Apartments – check prices now!
• Jabal Akhdar Hotel – check prices now!
• Anantara Al Jabal Al Akhdar Resort – check prices now!

Click here for the best Nizwa Hotel prices

Nizwa is the perfect base for both Nizwa itself and the Jebel Akhdar mountain range and most sights are reachable in less than an hour. One of the highlights of the area is the Nizwa Fort, one of the most popular tourist attractions in Oman, and the adjoining souq. Nizwa Fort itself is huge and can take a few hours to explore. The souq shops have a huge range of random trinkets and souvenirs and enjoyable to browse.

Jibreen Castle

Jibreen, or Jabreen, Castle is a beautifully restored castle located in the middle of a palm grove. The castle is definitely worth a stop when exploring around Nizwa.

Bahla Fort is a UNESCO World Heritage site that was refurbished in 2012. There is limited information for visitors but the impressiveness of the site makes it worth a stop.

Al Ayn Beehive Huts

If you’re feeling like a drive we highly recommend a trip to the Al Ayn Beehive Huts , a UNESCO World Heritage Site. The archaeological site of Al Ayn is part of a group of necropolises, alongside Bat and Al-Khutm, which form the UNESCO World Heritage site. Al Ayn is the closest to Nizwa and the most impressively preserved of the three. The Al Ayn Site is nestled on a hilltop in a stunning setting with a mountain range in the background. It was one of our favourite places in Oman.

The Al Hajar mountains

There are two options for an overnight in the Al Hajar mountains: Jebel Shams and Jebel Akhdar.

Jebel Shams is for the most adventurous, with a 4×4 car recommended in order to climb the mountain road to the summit.

Jebel Akhdar is more easily reached and has better accommodation options, one of which is the spectacular Anantara Al Jabal Al Akhdar Resort .  The views from this hotel are simply amazing and if you want to indulge on your night in the mountains, reserve a night in the resort!

Click here to book the Antara Al Jabal Al Akhdar Resort

Day 6: Wahiba Sands

Most visitors to Oman wish to spend at least one night in the desert. Wahiba Sands is the closest desert to Muscat and Nizwa. It’s easily reached from Muscat or Nizwa in a few hours thanks to the new road that is almost fully complete.

Although there were many amazing places in Oman, the highlight of our trip was the night in the desert. The sunset dune experience is a real bucket list experience and one we’ll never forget.

Oman itinerary tip: To make the most of your time in the desert aim to arrive at the camp at around lunchtime as this will allow you to explore camp and relax for a few hours before sunset.

Many of the camps offer additional activities such as camel riding, dune bashing, quad biking and dining experiences in the dunes. Dune bashing is one of the most fun, where expert guides take you on a rollercoaster drive through the dunes!

Oman Itinerary Tip: You will need a 4×4 vehicle with good road clearance to drive into Wahiba Sands. One you leave the main road and enter the desert the road is sand and is only accessible with a 4×4. We had a Toyota Landcruiser which was perfect when the sand got deep, however most hotels offer pickup from the main road if you don’t have a 4×4.

Where to Stay in Wahiba Sands

Accommodation in Wahiba Sands consists mostly of small boutique camps. They range from basic Bedouin tented camps to more luxury options. Desert nights tend to come at a premium price but the experience is more than worth the splurge. We opted for the luxurious Desert Nights Camp resort and loved every second. Watching the sunset over Wahiba Sands dunes was breath-taking and truly a once in a lifetime experience.

• Desert Nights Camp – with 39 luxurious Bedouin-style tents and a fantastic on-site restaurant this was our pick for staying in Wahiba Sands.. Rates include a delicioius breakfast and an evening meal and the tents were beautiful  – check prices now!

• Starwatching Private Camp – for those who want a truly authentic Bedouin experience try the Starwatching Private Camp. The camp comprises of just two tents and is set 25km from the road in the Wahiba Sands dunes – check prices now!
• Arabian Oryx Camp – Located close to Desert Nights Camp, the Arabian Oryx is another great Wahiba Sands option  – check prices now!

Click here to book your stay in Wahiba Sands

Day 7: Sur and Wadi Bani Khalid

The drive from Whaiba Sands to Sur is relatively straight foward but make sure to allow time in the morning to visit one of Oman’s best-known Wadis, the Wadi Bani Khalid. 

Wani Bani Khalid

Wadi Bani Khalid is one of the best wadis for swimming in Oman and is a short detour off the road from Wahiba Sands to Sur. The wadi itself is a 10-minute walk from the car park and is a great place to sit back, relax and enjoy a swim in the cool waters on a hot Omani day.

Oman itinerary tip: Wadi Bani Khalid is popular with locals and tourists alike and, as such, conservative swimwear is required – women should bring a top and shorts to cover swimsuits and bikinis.

The coastal town of Sur is perfect for a stopover between the desert and the turtle reserve of Ras al Jinz. The town is still famous for its traditional dhow shipbuilding and the forts, corniche and Al Ayga Lighthouse are nice to see.

Where to Stay in Sur

• Zaki Hotel Apartment – check prices now!
• Al Ayjah Plaza Hotel –  check prices now!

Click here for the best Sur hotel prices

Day 8: Ras Al Jinz Turtle Reserve

Oman offers a once in a lifetime opportunity to witness the nesting of the endangered green turtle and Ras Al Jinz is world renowned. The reserve protects against human threats to the marine turtle population and has onsite accommodation with turtle viewing include in the rate.

Oman itinerary tip: The best time see the turtle hatching is during the summer months, between May and September. Non-guests are also able to reserve tickets for the turtle hatching if you prefer to stay elsewhere.

Where to stay in Ras al Jinz

There are 31 rooms onsite at Ras al Jinz and rooms comprise a mix of standard rooms and luxury eco-tents, both with private bathrooms – check prices now!

Day 9: Return to Muscat via Qalhat and the Bimmah Sinkhole

Having explored some of the best sights Oman has to offer, it’s time to return to Muscat. Don’t worry, with the UNESCO World Heritage site of Qalhat and Bimmah Sinkhole along the way, there are still some gems to explore en route!

A 2018 addition to the UNESCO World Heritage list, the Qalhat settlement is one of the oldest sites in Oman. When we visited in November 2018, the site was relatively undeveloped but the Mausoleum of Bibi Maryam is the stand out of Qalhat.

Bimmah Sinkhole

The 30-metre deep Bimmah Sinkhole, located between Dibab and Bimmah, is a stunning natural wonder and its emerald waters are impossible to resist. Our favourite explanation for this giant turquoise swimming pool is from the locals, who say it was created by a meteorite but water erosion is the more likely cause!

Oman itinerary tip: the sinkhole is accessible via a concrete staircase and we cooled down with a swim. There are nibbling fish in the water so expect a pedicure as you float!

Day 10: Depart Muscat/ fly to Salalah

Day 10 is a day of leisure until it’s time for your flight from Muscat. If you have extra time, we recommend extending your Oman itinerary to include Salalah and taking a flight to there from Muscat.

4 thoughts on “Oman Itinerary: The Ultimate 7 to 10 Day Guide (2023)”

Great suggestion, very valuble for our upcoiming trip to Oman Thank a lot

Would love to know what you would delete from this itinerary if you only had 7 full days for the trip? Thanks. Jeanne Connelly

I’d start with Muscat and Wahiba Sands and you’d probably have time to fit in one other place (like Nizwa, Jebel Akhdar for the Al Hajar mountains or the turtle reserve). If you are driving, you can base yourself in Muscat and cover lots on day trips.

Thanks so much for this! I can see you travelled with a baby. How were they during the trip and do you have any suggestions 🙂

Leave a Comment Cancel reply

Save my name, email, and website in this browser for the next time I comment.

Disclaimer:  As an Amazon Associate I earn from qualifying purchases.

Expedia Rewards is now One Key™

Oman Vacations & Trips from $455

Book a hotel + flight or car together to unlock savings.

• Things to do

I only need accommodations for part of my trip

Your Oman Vacation

Make planning your next big adventure a breeze with an Oman vacation package. Whether it's nature, history or something else that draws you here, our package deals will help you discover the best of it. Trying to piece together an itinerary for your trip to Oman? Don't miss leading cities like Muscat , Barr Al Jissah and Salalah . From the instant you book your Oman vacation to the second you come back home, Expedia will take care of you each step of the way.

Top destinations in Oman

The Latest Oman Vacation Packages

Reviewed on Mar 24, 2024

The Chedi Muscat

Reviewed on Apr 15, 2024

City Seasons Hotel Muscat

Reviewed on Oct 16, 2023

Aerotel - Airport Transit Hotel

Reviewed on Dec 9, 2023

GLOBALSTAY. New Apartments in Muscat Bay

Oman vacation.

Explore Wadi Ghul, Oman's answer to the Grand Canyon, go on a four-wheel drive adventure through the shifting sands of Wahiba Dunes and see migrating sea turtles lay their eggs along the beaches of the eastern coast. A trip to Oman dazzles at every turn.

Oman Hotel + Flights

If you’re interested in stretching your vacation budget, bundle your hotel and flights into a neat Oman Vacation Package. You can also add experiences and car rental — you’ll have that itinerary sorted in no time! Need some inspiration? Add a dolphin tour off the coast of Muscat to your flights and hotel package.

Your Oman Vacation Itinerary

Day 1-2: Start your journey in the serene seaside capital, Muscat. Search for treasures in the city’s many souks (open markets) before checking out the beautiful adjoining city of Old Muscat. Sultan Qaboos Grand Mosque and the stunning Royal Opera House are must-sees while you’re here.

Day 3-4: Rent a car and venture onward to Nizwa, one of Oman’s oldest cities. Nizwa Fort, Jabreen Castle, Al Hoota Cave and Sultan Qaboos Mosque deserve to be on your itinerary here.

Day 5-6: Continue to the Al Hajar Mountains. Home to Oman’s tallest mountain, Jabal Shams, this area is a popular stop with travelers. For a view you won’t forget, take a hike on the Wadi Ghul Balcony Walk. Also set aside time to visit Wadi Bani Khalid, a beautiful desert oasis.

Oman Information

Soak up the diversity of Oman’s culture and traditions at Muscat Festival. It’s held between January and February each year.

Planning to spend a while in the capital? Browse our Muscat Vacation Packages .

There’s nothing like letting someone else take care of all the little details. Kick back and relax with our Oman All Inclusive Hotels .

Oman Essential Information

Oman hotel deals.

Reviewed on Apr 21, 2024

Reviewed on Apr 26, 2024

Explore other types of vacation packages

All Inclusive Vacations

Beach Vacations

Kid Friendly Vacations

Golf Vacations

Luxury Vacations

Romantic Vacations

Ski Vacations

Where to go when

Frequently asked questions, discover the most popular places to visit in oman, muttrah souq.

This ancient marketplace today features winding alleys of stalls selling antiques, traditional fabrics, aromatic spices and fresh produce.

Jebel Shams

Commune with nature and explore the great outdoors at Jebel Shams during your travels in Rustaq. Discover the area's mountain views and sunrises.

Sultan Qaboos Grand Mosque

Muscat’s main mosque is lavishly decorated with elaborate carvings, one of the world’s largest Persian carpets and colorful hibiscus flowers.

Other vacations you might like

• Top cities in Oman
• Vacations and getaways similar to Oman
• Popular destinations in Oman
• Best vacation destinations by month
• Expedia's Latest Trends
• Muscat Vacations
• Salalah Vacations
• Nizwa Vacations
• Zighy Bay Vacations
• Khasab Vacations
• Bidiya Vacations
• Sohar Vacations
• Sur Vacations
• Al Hamra Vacations
• Al Hadd Vacations
• Musannah Vacations
• Mirbat Vacations
• Egypt Vacations
• Israel Vacations
• United Arab Emirates Vacations
• Kuwait Vacations
• Pakistan Vacations
• Saudi Arabia Vacations
• Qatar Vacations
• Lebanon Vacations
• Jordan Vacations
• Palestinian Territories Vacations
• Musandam Governorate
• Al Batinah North Governorate
• Ash Sharqiyah South Governorate
• Dhofar Governorate
• Ad Dhahirah Governorate
• January Vacations and Deals
• February Vacations and Deals
• March Vacations and Deals
• April Vacations and Deals
• May Vacations and Deals
• June Vacations and Deals
• July Vacations and Deals
• August Vacations and Deals
• September Vacations and Deals
• October Vacations and Deals
• November Vacations and Deals
• December Vacations and Deals

Your Ultimate Guide to an Unforgettable 5-Day Itinerary in Oman

Oman, a country known for its diverse landscapes and rich cultural heritage, is a perfect destination for a 5-day adventure. From ancient forts to tranquil beaches, this itinerary will guide you through the must-see attractions and activities, ensuring an unforgettable experience.

Table of Contents

5-Day Oman Itinerary

Day 1: muscat.

• Morning : Begin your journey in Muscat, the capital of Oman. Visit the iconic Sultan Qaboos Grand Mosque, known for its stunning architecture and serene ambiance.
• Afternoon : Explore the vibrant Muttrah Souq, where you can shop for traditional Omani goods and souvenirs. Don’t miss the opportunity to take a stroll along the picturesque Corniche.
• Evening : Enjoy a delicious Omani meal at a local restaurant and immerse yourself in the city’s bustling atmosphere.

Day 2: Nizwa and Jebel Shams

• Morning : Depart for Nizwa, a city with a rich history and home to the historic Nizwa Fort. Explore the traditional Nizwa Souq and experience the authentic Omani market culture.
• Afternoon : Head to Jebel Shams, the highest mountain in Oman, and marvel at its breathtaking vistas. Engage in hiking or simply relax amidst the stunning natural beauty.
• Evening : Spend the night stargazing at the tranquil mountain retreats, offering a perfect end to an adventurous day.

Day 3: Wahiba Sands

• Morning : Embark on an exhilarating desert adventure in the Wahiba Sands. Experience a thrilling dune-bashing ride and witness the mesmerizing golden dunes stretching as far as the eye can see.
• Afternoon : Immerse yourself in the Bedouin culture with a visit to a traditional desert camp. Enjoy a camel ride and savor a traditional Omani meal.
• Evening : Witness a captivating sunset over the vast desert landscape, creating a truly magical and unforgettable experience.

Day 4: Sur and Daymaniyat Islands

• Morning : Explore the coastal town of Sur, known for its rich maritime heritage. Visit the dhow shipyards and learn about the traditional art of boat building.
• Afternoon : Embark on a boat tour to the Daymaniyat Islands, a pristine marine reserve. Snorkel in the crystal-clear waters and discover the vibrant underwater world teeming with marine life.
• Evening : Relax on the tranquil beaches of the Daymaniyat Islands and unwind amidst the unspoiled natural beauty.

Day 5: Muscat

• Morning : Return to Muscat and visit the Bait Al Zubair Museum to delve into Oman’s rich cultural heritage. Explore the contemporary National Museum for a deeper understanding of the country’s history.
• Afternoon : Take a leisurely walk around the picturesque Old Muscat area, home to the Al Alam Palace and the historic forts of Mirani and Jalali.
• Evening : Conclude your journey with a delightful Omani coffee and reflect on the unforgettable experiences and memories created during your 5-day adventure.

What to Prepare

• Visa : Check the visa requirements for Oman and ensure all necessary travel documents are in order.
• Transportation : Consider renting a car for the duration of the trip to have the flexibility to explore at your own pace.
• Accommodation : Book accommodations in advance, ranging from luxury hotels to traditional desert camps, to ensure a comfortable stay throughout the itinerary.
• Attire : Pack comfortable clothing suitable for both city exploration and outdoor activities and respect the local dress code and customs.

Whether you’re a history enthusiast, nature lover, or adventure seeker, this 5-day Oman itinerary offers a perfect blend of cultural immersion and breathtaking landscapes, promising an unforgettable travel experience.

Related Posts:

• The Ultimate 5-Day Maine Itinerary: Unforgettable Adventures Await
• Explore Vienna and Budapest: An Unforgettable 5-Day Itinerary [Topic]
• Explore the Beautiful Philippines: Your Ultimate 5-Day Itinerary [Topic]
• Exploring the North East: Your Ultimate 5-Day Itinerary [Topic]
• Explore the Beauty of Kyushu: Your Ultimate 5-Day Itinerary [Topic]
• Mysore Itinerary For 1 Day: Explore The Best Of Mysore In A Day
• Hotel Xcaret Itinerary: A Complete Guide To Your Dream Vacation
• What Does A Flight Itinerary Look Like: A Complete Guide
• Where Can You Find Smalls Cat Food? Your Guide to Locating the Perfect Supplier
• How to Easily Determine if Cacao is Ripe: A Step-by-Step Guide
• How to Master the Art of Using Mini Pie Molds: A Step by Step Guide
• How to Create an Amazing Travel Itinerary Using Google Docs
• How to Determine When Your Meyer Lemon Is Ripe
• Can You Turn Your Home into a Doordash Restaurant?
• How to Prevent Powdered Sugar from Melting into Your Perfectly Baked Cake
• How to Create Perfect Whipped Cream Decorations for Your Pies
• How to Cancel Your Travel and Leisure Magazine Subscription: FAQs

• 3 Other destinations
• 4.1 History
• 4.2 Climate
• 4.4 Religion
• 4.6 Visitor information
• 6.2 Customs
• 6.3 By plane
• 6.4 By boat
• 7.1 By plane
• 7.3 By taxi
• 10.2 Shopping
• 15 Stay safe
• 16 Stay healthy

The Sultanate of Oman ( Arabic : سلطنة عُمان) is on the eastern side of the Arabian Peninsula . Under the radar of most visitors to the Gulf, Oman is peaceful and prosperous, with amazing natural sights and hospitable people.

Regions [ edit ]

Oman has two exclaves separated from it by the United Arab Emirates , the Musandam Peninsula and Madha .

Cities [ edit ]

• 23.613889 58.592222 1 Muscat - the historic capital and largest city
• 22.966667 57.3 2 Bahla - oasis town which is home to a UNESCO World Heritage Site
• 22.683333 58.55 4 Ibra - gateway to the Wahiba Sands
• Matrah - adjoining the capital city and just as historic
• 22.933333 57.533333 5 Nizwa - contains one of the best-known forts in Oman
• 17.019722 54.089722 6 Salalah - the south, which is almost tropical at the time of the Kareef
• 24.342 56.729889 7 Sohar - one of the legendary homes of Sindbad
• 22.566667 59.528889 8 Sur - where dhows are still made by hand

Other destinations [ edit ]

• 23.214861 57.275189 1 Hajar Mountains - a majestic range, the highest in the Arabian Peninsula, which stretches into the United Arab Emirates .
• 25.284444 56.333056 2 Madha - tiny exclave of Oman completely surrounded by the United Arab Emirates
• 20.471111 58.815278 3 Masirah Island - a real desert island experience awaits on this haven for turtles and other wildlife
• 26.198094 56.249189 4 Musandam Peninsula - a rocky exclave on the Straits of Hormuz with some magnificent wadis
• 22 58.833333 5 Wahiba Sands - massive rolling dunes as far as the eye can see

Understand [ edit ]

Until Sultan Qaboos bin Said exiled his father, the previous Sultan, in 1970, Oman was an under-developed nation, almost completely closed to visitors and badly manipulated by the British, although never annexed. After the accession of Qaboos, education, public works and tourism took off throughout Oman.

Omanis are friendly people and very helpful to visitors. In turn, tourists should respect the ways and traditions of the Omani people.

Omanis are proud of their country's rapid progress and of their heritage as one of the great seafaring nations. Excellent schools and hospitals, good governance, and on-going infrastructure improvements are all important characteristics of this once introverted and closed nation.

History [ edit ]

The oldest known human settlement in Oman dates to the Stone Age.

Sumerian tablets refer to a country called Magan, a name thought to refer to Oman's ancient copper mines. The present-day name of the country is believed to originate from the Arab tribes who migrated to its territory from the Uman region of Yemen . Many tribes settled in Oman making a living by fishing, herding or stock breeding and some present day Omani families are able to trace their ancestral roots to other parts of Arabia.

From the 6th century BCE to the arrival of Islam in the 7th century CE, Oman was controlled or influenced by three Persian dynasties: the Achaemenids, Parthians and Sassanids. By about 250 BCE the Parthian dynasty brought the Persian Gulf under their control and extended their influence as far as Oman and established garrisons in Oman. In the third century CE the Sasanids succeeded the Parthians and held the area until the rise of Islam four centuries later.

In the 21st century, Oman is positioning itself as a hub for diplomacy in the Middle East, having played an important role in mediating the rapprochement between Saudi Arabia and Iran in 2023.

Climate [ edit ]

The climate generally is very hot, with temperatures reaching 54°C (129°F) in the summer, from May to October.

Annual rainfall in Muscat averages 100 mm (3.9 in), falling mostly in the winter. Dhofar is subject to the southwest monsoon, and rainfall up to 640 mm (25.2 in) has been recorded in the rainy season from June to September.

While the mountain areas receive more plentiful rainfall, some parts of the coast, particularly near the island of Masirah, sometimes receive little to no rain at all within the course of a year.

Read [ edit ]

• Explorer Publishing , Oman Off-road: 26 Adventurous Routes . Given the dearth of available topo and road maps for the country, this book is indispensable for visitors looking to explore Oman's most outstanding sights, many of which are off the tarmac. Routes and points of interest are described in detail, with satellite imagery and GPS coordinates. Outside of the Gulf region the book may be difficult to find, but it is usually in stock at the bookshop in the arrivals terminal at the Muscat airport, as well as in select bookshops in the city and in the UAE, where it is published.

Religion [ edit ]

Officially Oman is a Muslim state, and the Sultan and the vast majority of Omanis are Ibadi Muslims . However, Oman is a very tolerant country; there is a significant Sunni minority in Salalah, Sur and the northern parts of Oman and active Shiite communities in Muscat, Suhar, Al- Khabourah and Saham. Hindus have their temples in Muscat and one is said to be at least 350 years old.

People [ edit ]

Omani citizens make up the majority of Oman's total population and consist of many different ethnic groups. Oman is home to its shipbuilders, who over the passage of time, have mastered the design of wooden trading ships.

Visitor information [ edit ]

• Oman Tourism website

Talk [ edit ]

Arabic is the national language, but most Omanis will speak good to excellent English, and particularly so in major tourist areas and cities. An English-speaking traveller should have no language difficulties unless he or she really travels "off the beaten track".

The historical presence of Indian traders has meant that Hindi or Urdu will be understood in some urban areas. In the southern Dhofar region, a Semitic language called "Jibbali" is spoken. Swahili, and Baluchi are languages spoken by ethnic minorities in Oman, especially in the capital Muscat. The presence of a large number of expatriates from the Indian state of Kerala , has made Malayalam a prominent language.

Get in [ edit ]

Visas [ edit ].

Citizens of the Gulf Cooperation Council (GCC) countries ( Bahrain , Kuwait , Qatar , Saudi Arabia and the United Arab Emirates ) may enter Oman without a visa and stay indefinitely.

A single entry visa can be obtained upon arrival at any air, land or sea terminal by citizens of the following countries:

• EU citizens and other Europeans including nationals of Iceland , Liechtenstein , Monaco , Norway , San Marino , Switzerland and Vatican City but not Cyprus and Malta .
• Albania , Andorra , Argentina , Australia , Bolivia , Bosnia and Herzegovina , Brazil , Brunei , Canada , China , Chile , Colombia , Croatia , Ecuador , French Guyana , Hong Kong , India , Indonesia , Japan , Macau , Malaysia , Moldova , New Zealand , North Macedonia , Paraguay , Peru , Russia , Seychelles , Singapore , South Africa , South Korea , Suriname , Taiwan , Thailand , Turkey , Ukraine , United States , Uruguay and Venezuela .

The 30-day visa costs 20 rials, 10-day one - 5 rials. You can pay online before arrival at the Royal Oman Police e-visa website or at MCT airport where you need to get the visa from the money changers which add a 1 rial commission. Your passport should be valid for no less than 6 months from the date of arrival. Any visa fees can be paid using UAE dirhams at a rate of ten dirhams to one Omani rial. At the airports, visa fees can be paid in any Gulf Co-operation Council currency, euros, and US dollars.

Oman has a common visa facility with the Emirate of Dubai. If you pass through Dubai immigration and are granted a visa to Dubai for at least 3 weeks, you will then be entitled to a free-of-charge visa for 3 weeks to Oman. You will need to show your passport stamp from Dubai to the Omani immigration officers. Visas are sold by private businesses at some ports of entry and these people may not be familiar with this and will try to convince you that you need to buy a visa from them. If it is your first visit to that particular port of entry, it may be difficult to know how to navigate past these people. If you make it to an immigration officer they will be familiar with the visa fee waiver and allow you to enter without paying. The countries benefiting from this type of visa are: Portugal, Spain, France, Switzerland, Italy, Britain, Sweden, Greece, Austria, Ireland, Finland, Germany, Iceland, Belgium, Norway, The Netherlands, Denmark, South Korea, Japan, Brunei Darussalam, Malaysia, New Zealand, USA, Canada, Australia, Singapore, Hong Kong, Luxembourg, Vatican City, Monaco, Andorra, and San Marino.

This scheme is with the Emirate of Dubai only and not with other emirates of the UAE, therefore, if you enter the UAE via Abu Dhabi or elsewhere, then your UAE visa will be granted by some other emirate and while this allows you to travel within the UAE and to Dubai, the Omani visa fee will not be waived.

Citizens of Egypt , Iran , Jordan , Morocco , and Tunisia can apply for a one-month visit visa only at air terminals.

The visa can be extended another month by submitting your passport to the Royal Omani Police in Muscat, however there is one line, and the wait can be as long as 2 hours. The concept of personal distance is different in the Middle East than it is in Europe. Queue jumping may be a problem for Europeans unless you set aside that personal distance concept. If you are on a budget and need to extend your visa, consider taking a trip to the United Arab Emirates . Buses are 10-12 rials return. A same-day round trip flight to Sharjah on Air Arabia costs about 50 rials. Even a taxi would be an option. Visa is not required for nationals of Gulf Cooperation Council (GCC) member states and a short stay visa will be granted on arrival to residents of GCC member states and regardless of nationality.

GCC expatriate residents are granted a visit visa valid for up to 4 weeks (extendable by 1 week) for a fee of 5 rials.

Customs [ edit ]

It is prohibited to bring firearms, narcotics or pornographic publications into Oman. Non-Muslims are permitted to bring two litres of alcohol into the country at Muscat International Airport only. You are not allowed to bring alcohol into the country in private cars at land border crossings.

By plane [ edit ]

Virtually all international flights arrive at Muscat (Seeb) International Airport ( MCT  IATA ) in Muscat. There are also regional international flights to Salalah ( SLL  IATA ). Purchasing a visa on arrival in Salalah can be quite difficult, as the airport is small and immigration officials tend not to have change for larger notes.

Oman Air is the flag carrier of Oman, operating an extensive network of flights around the Middle East and India, but only select destinations in Europe and Asia. Most large Middle Eastern and European airlines also fly to Muscat. The most frequent connections are via Dubai (DXB).

By boat [ edit ]

The port in Muscat is used by cruise ships. There are regular ferry and fastboat lines between island Masirah and Shannah port. Additionally, there are fastboats from Musadam peninsula and city Khasab and ferry port Shinas in Northern Oman. Schedule and booking on NFC Online page.

By car [ edit ]

There are multiple border crossings from the United Arab Emirates into Oman some of which are listed below:

• Hatta border at Wadi Hatta and Al-Wajajah (this crossing can only be used by GCC Nationals)
• Wadi Jizzi between Sohar and Buraimi,
• Jebel Hafret leading to Ibri and Nizwa,
• Khatmat Milahah from Fujairah
• from Ras al Khaimah emirate to Bukha/Musadam
• from Fujeirah emirate to Dibba/Musadam.
• Al Ain (Abu Dhabi) 3 border posts, 24.21077 55.95367 1 Khatam Al Shukla ( Khattm Al Shiklah ) street border post (serving expatriates)

Driving directions and border crossing from Abu Dhabi to Muscat - For Abu Dhabi residents crossing to Oman, there are 3 border posts in Al Ain - Buraimi Border post (reserved exclusively for GCC Nationals)), Hilli Border post (also exclusively for GCC Nationals) and Khatam Al Shukla street border post (serving expatriates, you will not find any traffic signal in the city indicating the direction of the border).

Roads are excellent and the border crossing is quite easy. Don't forget to bring along some cash, as you have to pay for the visa to enter Oman, and also, as of 2019, many petrol stations, especially in southern Oman, take only cash. If you are taking a car from the UAE into Oman, you will need to produce evidence at the border that the car is insured in Oman. There is a departure tax of 35 UAE dirhams when leaving the UAE by car, and an 2 rials tax when leaving Oman by road.

Weekends and public holidays are very busy at the various borders that UAE shares with Oman as residents and visitors cross into Oman for tourism purposes as well as visa runs. Crossing during the work week (Sunday to Thursday) will avoid much of the crowds.

Additionally, make sure that your passport is stamped with the relevant entry and exit stamps. This should go without saying, but some border officials will forget part of the procedure and cause administrative hassles later. Additionally, crossing from Oman to the UAE is often a chaotic business, so it is easier to miss out on the all-important stamp than one might expect.

Crossing from Oman to Yemen is significantly more challenging, and those of an adventurous bent should familiarise themselves very carefully with the regulations regarding that border. In previous years, there has been a law that no solo female travellers can exit Oman to Yemen. Additionally, bear in mind that the easternmost parts of Yemen are exceptionally remote.

While a border (unmarked) exists between Oman and Saudi Arabia , this is a very inadvisable crossing, as it involves going through most (if not all) of the Empty Quarter and there are no permanent roads.

By bus [ edit ]

There is a regular bus service between Muscat and Dubai in the UAE. There are private operators as well as the state owned Mwasalat (formerly Oman National Transport Company) and the ride (which usually takes between 4 and 5 hours) is quite comfortable, thanks to the excellent roads.

Mwasalat operates the Dubai to Muscat and Dubai to Salalah routes. The bus to Muscat departs from Al rigga road in Deira, Dubai at 07:15 and in the afternoon. The bus to Salalah departs at 15:00 from the same bus station. The tickets are bought at Al Manhal stationery by the bus stop and cost 55 UAE dirhams one way to Muscat (Dec 2010). The bus stop is hard to find, it is close to the Caravan restaurant and close to the Dnata building, the taxi drivers know where the bus stop is. To go to Nizwa you need to go with the Salalah bus. Dress warm for the bus ride and prepare for border control including baggage check! If you enter UAE through Dubai you don't need to pay for Visa for Oman, show your stamp at the border control.

Get around [ edit ]

Oman Air is the national carrier and flies regularly between the two airports in the country (Muscat/Seeb, and Salalah). Air Arabia offers flights to Salalah and Muscat from the United Arab Emirates (UAE).

There are regular, daily bus services connecting the bigger cities within Oman ( Muscat , Salalah , Sohar , Sur and Nizwa ). There are several, daily bus services from Muscat to Dubai. There is one bus a day from Muscat to Abu Dhabi. For details see the pages of the Oman National Transport Company [1] .

Mowasalat is state-operated public transportation company in Oman. The company operates bus lines which connect some of the major cities in Oman.

By taxi [ edit ]

All taxi drivers in Oman are Omani nationals as this is a protected profession. In Muscat there are call/telephone taxi services. Whilst safe and generally turn up when you want them to the costs are comparatively high. Look for "Hello Taxi" and "Muscat Taxi" amongst others.

The orange-badged taxis are usually owner-operated, these are un-metered with negotiated fares before departure. If you get a very cheap price, then do not be surprised if the Taxi stops to add extra passengers unless you request for it to be private. You may ask for engaged , just say 'engaged taxi' to the driver, and you will pay for all the seats (4) and now have the taxi to yourself. Women must always sit alone in the back. This is for your own safety and comfort.

There are also mini-buses (Baisa buses), the principle is you share the bus or car with others and pay a lower price as a result. This is how women living in Oman travel if they must use public transport. Women should sit next to other women if there are any in the bus. Men should move to other seats. If they do not move immediately, simply stand at the door, looking at them expectantly. They will take the hint and move. Although this might feel strange to foreigners, it is expected behaviour for Omanis. Not sitting next to a man will avoid any unfortunate situations of mixed signals.

Driving around Oman in your own (rented) car is quite easy. A four-lane road connects Muscat and Nizwa and a four-lane highway goes from Muscat to Sur (however, between Muscat and Quriyat it is still one lane each way through the mountains).

There are still large parts of the Sur - Muscat route that has no mobile phone signal. If you break down be prepared to wait it out. Or hitch a ride to the next town and find a mechanic to bring back to your vehicle.

Lovely seaside camping can be found between Muscat and Sur. Best to take the paved route to Sur, then over to Wadi Shab to find your way safely into this coastal road. If you intend to drive in wadis (unsealed valley roads in river beds) a 4WD is highly desirable. You can never be sure how the road will be and if it starts raining the wadis will turn into rivers quickly.

If at all possible, hire a 4-wheel drive. There is spectacular off-road driving to be had in Oman, and you will want to veer off the tarmac again and again.

Since about 2001 Oman has been experiencing severe flash flooding annually. The force of the water rushing down the rock hard treeless mountains do push even landcruisers off the road and upside down. Beware . If you see dark clouds or rain starts, find high dry ground, shelter and stay put. You can put a call into the local authorities to see if they can advise you better. The problem is the flash floods move quickly from town to town; it is easy to get trapped by washed out roads. Many wadi crossings have white and red poles to indicate when it is safe to cross the wadi in case of a flood. These are painted white on the bottom and red on top. If the water level reaches the red-painted part, do not attempt to cross, even in a 4WD.

If you managed to get a map of Oman regard it as how Oman would like to have the roads. Some roads might be drawn as well-built streets but are not even paved. Roads not visible on the map might just end and may even be painted till the end!

The typical rented car has a limit of 200-250 km per day. Prepare to pay and negotiate for extra kilometres. Monthly rates sometimes include unlimited kilometres.

Petrol in Oman is very cheap by European and even North American standards. As of June 2016 the price for regular petrol was approximately 0.17 rials per litre, even cheaper than in neighbouring United Arab Emirates .

In order to try and limit the rather frightening road death toll, the motorways/dual carriageways are littered with speed cameras. In the centre of Muscat they are every 2 km, not all look like they are active - but be warned. According to locals, the tolerance on the speed cameras is 19 km/h.

See [ edit ]

Oman is famous for its historic forts which are the country's most striking cultural landmarks. There are over 500 forts and towers which were the traditional defence and lookout points to deter potential invaders. Some of the best examples are in the capital, Muscat . Jalali and Mirani forts stand at the entrance to Muscat Bay and date from the early 16th century.

Bahla Fort at the base of the Djebel Akhdar highlands is a UNESCO World Heritage Site and has 7 miles of walls. It was built in the 13th and 14th centuries when Bahla was a thriving oasis town.

Oman's rugged mountains offer some stunning scenery and probably the best opportunities for driving in dry wadis anywhere in the world. Many of the wadis have made roads (often unsurfaced but decent enough) while others require serious off-roading. You can easily get well off the beaten path into remote areas.

Huge desert dunes roll for as far as the eye can see at Wahiba Sands .

Oman's beaches are major breeding locations for various species of sea turtle . Masirah Island is the perhaps best bet where four species breed, including the largest number of leatherbacks anywhere in the world.

The country has vast expanses of desert, hundreds of kilometres of uninhabited coastline, and mountains of over 2,740 m (9,000 feet).

Do [ edit ]

• Drive off-road to explore Oman's most outstanding sights.
• Go scuba diving off the coast of Oman in places like Masirah .
• Visit tribal Bedouin villages in the Musandam Exclave .
• Take a cruise on a dhow , an Omani/Emirati traditional fishing boat.

Buy [ edit ]

Money [ edit ].

The currency in Muscat is the Omani rial , denoted by the symbol " ريال‎ " (ISO currency code OMR ). Wikivoyage uses "RO" to remote the currency. One rial is made up of one thousand baisa (also written baiza , Arabic: بيسة). The Omani rial is tied to the US dollar at 1 rial = US$2.6008 making it one of the largest units of currency in the world; exchange rates on the streets are a percentage point or two lower.

Banknotes that circulate are in 0.100 rials (a small, green banknote and not to be confused with the 20-rial note), 0.500 ( 1 ⁄ 2 ) rial, 1, 5, 10, 20 and 50-rials. Coins in circulation in Oman come in denominations of 5, 10, 25 and 50 baisa.

There are ATMs at the airport and plenty of them in Muscat and every main town, although not all of them take foreign cards. You can change foreign currency at the counters inside the airport and at money exchanges throughout Oman.

Shopping [ edit ]

The Omani national symbol is the silver-sheathed dagger known as the khanjar . These vary widely in quality and cost, but almost every shop will stock several different models. Most of the modern ones are made by Pakistani or Indian craftsmen under Omani direction, while many are actually made in Wazirabad Pakistan or India. There is a large variety in quality, from the handles to the sheath. The best handles are made of silver-adorned sandalwood, while the lesser quality handles are made of resin. Look carefully at the sheath to determine the quality of the silver work. A good quality khanjar can cost more than 700 rials. Typically, those will come in a presentation box, and include a belt.

Another reminder of the country's tribal past is the walking stick known as arsaa . This is a cane with a concealed sword in it, which can prove quite a talking point at home. In many countries, it will prove a talking point with customs officials rather than friends and family. In Musandam, the khanjar is frequently replaced by the Jerz as formal wear, a walking stick with a small axe head as the handle.

Omani silver is also a popular souvenir, often made into rosewater shakers and small "Nizwa boxes" (named for the town from which they first came). Silver "message holders" (known as hurz, or herz), often referred to in souks as "old time fax machines" are often for sale as well. Many silver products will be stamped with "Oman" on them, which is a guarantee of authenticity. Only new silver items may be so stamped. There is a large quantity of 'old' silver available which will not be stamped. Although it may be authentic, stamping it would destroy its antique value. Caveat emptor are the watch words. Stick to reputable shops if you are contemplating buying antique Omani silver of any sort.

There is a wonderful selection of Omani silver available as jewellery as well. Items for sale in the Muttrah souk may not be genuine Omani items. Instead visit Shatti Al Qurm just outside of Muscat or the Nizwa Fort.

For any purchases of silver, knives, and sword-canes, make sure that you can legally import the amount you purchase back into your home country. Travelers thinking of bringing their purchases home via airplane should rather mail their purchases back, as it is usually an easier way since you won't have to cart the purchases around Oman or through security and customs.

The distinctive hats worn by Omani men, called "kuma", are also commonly sold, particularly in the Muttrah Souk in Muscat. Genuine kumas cost from 80 rials.

Frankincense is a popular purchase in the Dhofar region as the region has historically been a centre for production of this item. Myrrh can also be purchased quite cheaply in Oman.

As one might expect, Oman also sells many perfumes made from a great number of traditional ingredients. Indeed, the most expensive perfume in the world (Amouage) is made in Oman from frankincense and other ingredients, and costs around 50 rials. You can also find sandalwood myrrh and jasmine perfumes.

Opening hours during the holy month of Ramadan are very restricted. Supermarkets are less strict, but don't rely on being able to buy anything after iftar. At noon, most shops are closed anyway but this is not specific to Ramadan.

Using credit cards in shops is hit or miss. It is better to get cash at an ATM. Small denomination notes are hard to come by but necessary for bargaining. Unless you are in a supermarket, restaurant or mall bargaining is recommended, and this should be conducted politely.

Eat [ edit ]

Omani food tends to be simple but rewarding and filling. Rice is the main staple and so is bread. The national dish is called " Qabuli", consisting of; spiced rice, lamb or chicken, split peas and caramelized onions. It can be found in many restaurants across the country. Another popular dish is "shuwa" which consists of a whole roasted lamb wrapped around banana or palm leaves and marinated in a plethora of different spices, before being buried underground and cooked for an overnight. Shuwa is often served with plain rice but in some upscale restaurants it can be served as a sandwich with fries and ketchup. You have to try harees whenever possible, which is a porridge-like dish of cracked wheat, ghee, chicken or beef and some spices. With a long coastline, Oman has a rich seafood culture and freshly caught fish served with a salad and rice is not unheard of for lunch.

Street food is now becoming a trend. Make sure to try shawarma- strips of chicken or lamb grilled on a rotating spit, shaved and served in a wrap with an abundance of pickles, vegetables, tahini sauce (if lamb) or garlic sauce (if chicken) and French fries or deep fried chickpeas and beans balls called "falafel". They can be found in many street corner cafeterias for a very cheap price. For an authentic delicacy try barbecued meat marinated in tamarind and chili called "mishakeek". It can be bought from the stalls along just about any beach in Oman.

Omani sweets are well known throughout the region, with the most popular being "halwa". This is a hot, semi-solid substance which behaves a little like honey and is eaten with a spoon. The taste is similar to Turkish Delight. Omani dates are among the best in the world and can be found at every social place and at offices.

Luckily, you can find just about any cuisine in Oman. Be it Japanese, Chinese, Thai, Lebanese, Persian, Turkish, Tex-Mex or Indian; it's all there! American franchises like McDonald's, Burger King, KFC, Pizza Hut and Papa John's are extremely popular, especially among the younger generations

Drink [ edit ]

Alcohol is available only in some restaurants and large hotels and is usually very expensive (ranging from 1.5 rials for a 500 ml Carlsberg to 4 rials). Drinking alcohol in public is prohibited, but you can get your own drinks and enjoy at public areas but in privacy such as camping by beaches, sands, mountains, or actually in any remote areas. Only foreign residents can buy alcohol from alcohol shops and with certain limits. But an alcohol black market is widely spread around the cities and alcohol can be found easily.

Foreigner travellers are allowed 2 litres of spirits as duty free baggage allowance. Visitors can buy spirits at the duty-free shop in the arrival lounge.

During Ramadan, drinking anything in public is prohibited, even for foreigners. Take care to drink in the privacy of your room.

Sleep [ edit ]

Oman has the full spectrum of accommodation - from ultra-luxurious hotels to extremely rustic huts in the desert constructed from date palm leaves.

Oman has been attempting to turn itself into something of a five-star destination for the well-heeled traveller, there are five five-star hotels in the capital. This does not pose a problem to the budget-minded in Muscat, and even outside of the capital there is still a range of budget options. In some parts of the country, however, accommodation may be limited to higher-end hotels and resorts.

Work [ edit ]

Working in Oman requires that you hold a residence permit. In common with other Gulf countries, you must be sponsored by an employer to obtain a residence permit. It's not uncommon for people to enter on a tourist visa then look for a job - this is fine. Penalties for the employer are substantial if they are caught employing illegals, although this naturally varies depending on how good their connections are.

The majority of positions are filled by expats from the sub-continent. Positions for Europeans tend to be restricted to upper management levels or specialised occupations, so don't expect to pick up a position as you pass through unless you are prepared to work for very little!

Stay safe [ edit ]

Homosexuality is a crime in Oman. LGBT tourists should be self-aware.

Driving in Muscat can sometimes be a problem, although this is due more to congestion than bad driving on the part of the locals. Outside of the major cities, a common driving risk is falling asleep at the wheel due to the long stretches of featureless desert. Driving in Oman calls for attention to the unexpected. It has 85.3 road fatalities per 100,000 motor vehicles, which is more than double the UAE and much higher than most European countries.

Omani drivers outside of the cities tend to drive very fast and pass with impunity. Driving at night is especially hazardous as many drivers fail to turn their headlights on, or are unaware of people crossing the road on foot for example on the road from Sohar to Muscat . Camels will walk into the road even if they see cars approaching, and collisions are often fatal for both camel and driver.

See the above section on driving in wadis for off-road safety.

Female travellers should be careful to dress modestly, as not to offend local customs.

Visiting gambling and adult sites is also a crime in Oman. Internet censorship in Oman is very serious, so you need to be careful to stay safe online.

Stay healthy [ edit ]

Bottled drinking (mineral) water is easily available at most stores. Tap water is generally safe; however, most Omanis drink bottled water and to be safe, you should too. 500ml bottles of water will generally cost 100bz in the majority of shops with a 1.5l bottle costing only 200bz.

Oman is warm year-round and summers can be extremely hot. Always carry drinking water with you and be wary of de-hydration in high temperatures. If you're not used to the heat it can sneak up on you and cause serious health problems.

Several people have tried to cross stretches of the Omani desert on their own in a rented 4WD. Some of these people have died or got rescued just in time.

Travelling through a desert requires proper preparation. It looks easy from a modern air-conditioned 4WD, but if that fails you are suddenly back to basics.

Never go off-road alone. A minimum of two to three cars (of the same make) is the rule. Leave your itinerary with a friend with clear instructions if you do not return in time. Take at least:

• recovery tools: spades, rope (and attachments), sand mats or ladders
• two spare tires and all required equipment
• a good air pump (high capacity)
• sufficient water (at least 25 litres more than you think you will need for drinking)
• sufficient petrol: there are no petrol stations in the middle of nowhere.

If you have – or can get – a satellite phone, take it. (Mobile phones work only in limited areas.) Check your car before embarking on such a trip.

Respect [ edit ]

Before he died in 2020, Sultan Qaboos did more to develop the nation than any Arab leader, or most world leaders in recent history for that matter. Qaboos is held in the highest regard — even revered — by the vast majority of Omanis. Visitors should refrain from making any comments or statements that could be construed as disrespectful.

The Omanis are generally humble and down-to-earth people. The usual rules of respect when travelling in a Muslim country should be followed in Oman, even when locals appear to be a little less "uptight" than their neighbours. Homosexuality is illegal due to Islamic law but is practised with discretion; however as elsewhere in the Gulf it is taboo to discuss such topics.

While Omanis may not say anything to foreigners who dress in tight or revealing clothing, it is considered to be very disrespectful. Yes, some visitors push the goodwill of the Omanis in choosing their attire, but a little sensitivity goes a long way. A rule of thumb is that women should always keep shoulders, knees, and midriff covered, and avoid tight or revealing clothing. For men, shorts should be worn only for outdoor activities; longer shorts (i.e. at or below the knee) are fine in the city.

Staring is quite common in Oman; children, men and women are likely to stare at you simply for being a foreigner, especially if you travel off-season and in out-of-the-way places. This is not meant as an insult, it rather shows an interest, and a friendly smile will leave children giggling and showing off, and the adults happily trying out their few English phrases. Depending on which area of Oman you are in, smiling, though, may not be a good idea. In larger areas in which the locals have had excessive amounts of one-on-one experience with foreigners, smile away. Outside of Muscat and Salalah, it's not advised to smile at anyone of the opposite sex regardless of how friendly they are (save for tour guides) as nearly any interaction with the opposite gender (even holding doors open, picking up something that has fallen and handing it to the owner, eye contact, etc.) is viewed as flirtatious. It is especially important for Western women to take into account that an innocent smile saying, "I see you seeing me, do you need something" means "I'm interested, come closer" to most Omani men. They live in a heavily gender segregated society and so any chance they have to speak to the opposite gender is usually viewed as having at least semi-sexual overtones.

Under Omani law, an Omani can be taken to court for insulting another person, whether it is calling them an insulting name (one of the more common Arabic insults of "donkey," "dog," "pig," "sheep," etc.) or worse. Omanis, although "humble" are extremely sensitive to anything they perceive as criticism whether personal, national, or anything they perceive as being directed at the Gulf. Although Saudi Arabia is usually a fair target for jokes in the Arab world (especially in the Levant), Omanis don't take well to it. What Westerners would usually consider hypersensitive is fairly normal in Oman and due largely to the fact that Omanis have grown up in an environment in which criticism and name-calling is more or less outlawed. This is especially important to know for those who come to teach Omanis, unlike those from the Levant and parts of north Africa where teasing and intellectual "jousting" can be used as a form of building relationships or a sign of friendship, it doesn't work here and Omanis do not interpret it positively, save for those who have lived in the West or have worked with Westerners for extended periods of time.

As Oman is a member of the Arab League, its stance on Israel is one much like the other members, including the boycott. However, the Omani government was one of the first to recognize the existence of Israel, and has essentially been a liaison between the Arab League and Israel on multiple occasions, including setting up a meeting between the Israeli government and PLO leaders in the mid-2000s. Oman allows foreigners who travel to Israel to enter it for similar reasons, but it still participates in the boycott and holders of Israeli passports (citizens of Israel and dual-citizens of Israel and another country) aren't allowed entry. Due to this, the topic of Israel is best left undiscussed.

While Oman is very socially and politically liberal compared to its neighbors in the region, it remains an absolute monarchy where criticism of the Sultan is rare and the citizens can't elect direct leaders (they can elect representatives for certain positions, but the true power remains with the Sultan). On the flipside, most Omanis loved and/or respected Sultan Qaboos, so very few Omanis ever lodge any complaints. It is best for the traveller to avoid talking about the Sultan in a negative manner, and with Omani politics in general.

The "official" state religion, the Ibadi branch of Islam, is one of the most tolerant branches of Islam, in stark comparison to the Wahhabist Saudi Arabia. Ergo most Omanis will be open and accepting with travellers of other religions and creeds. However, Islam is still taken very seriously in Oman (not as much as in other states, though), so the traveller should refrain from making anti-Islamic comments or degrading Islam.

Connect [ edit ]

The country code for Oman is 968 .

Dialling out from Oman you will need to dial 00 + International Code + Number

Dialling into Oman callers use +968 followed by an 8 digit number...

These 8-digit numbers generally start with a 9 if it is mobile number, and with 2 for land lines, though other numbers will eventually start to get used.

Pre-paid mobile SIMs are available from several counters at the airport arrivals area. Your passport details are required to register the SIM. Often the staff will be helpful in activating the SIM for use when you buy.

Cope [ edit ]

Visitors may be interested in the monthly English language lifestyle magazine, Oman Today [dead link] , which is widely available in Oman.

• Has custom banner
• Has map markers
• City listing with no coordinates
• Has VisaRestriction box
• Has VisaRestriction box with no date
• Airport code pages missing
• Articles with dead external links
• Has Geo parameter
• Articles Geo different to Wikidata
• Middle East
• All destination articles
• Outline countries
• Outline articles
• Country articles
• Pages with maps

Navigation menu

Tips & How to travel to Oman in 2024

By Joan Torres 22 Comments Last updated on April 29, 2024

Alluring Arab fortresses, 3000km of dramatic coastline, massive seas of dunes, thousands of miles of empty roads, and unspoiled landscapes.

Oman is the ultimate destination for raw adventurers, seeking to venture into the most traditional and welcoming Arab country.

This Oman travel guide contains everything you need to know to travel to Oman , including all the practical information, travel tips, top experiences and more.

In this Oman travel guide you will find:

Table of Contents

• Best time to visit
• Travel insurance
• Useful books
• Top 5 experiences
• Tours or independent travel?
• 20 Cultural facts
• Money and budgeting
• Transportation
• How to get in
• Accommodation
• More information

our recommended travel insurance for Oman

With its Backpacker plan, IATI Insurance is the best insurance for any kind of adventurous destination, like Oman.

😍 Reasons to visit Oman, the most welcoming country in the Middle East

I have visited Oman 7 or 8 times. 

The fact is that I lived in Dubai for nearly 3 years, and going to Oman was the classic weekend getaway. 

Two years after leaving Dubai and my corporate job , I came back to the region and decided to travel around Oman for a whole month, this time without a car, right before making my way into Saudi Arabia .  

I love Oman, I absolutely love it, for many reasons, but mainly because, unlike the United Arab Emirates, Qatar or Kuwait, it has managed to keep its own character.

Oman is an oil-rich country, but they don’t need to spend billions building extravagant buildings and nonsensical monuments. No, they don’t need to because people visit Oman to meet the kind-hearted Omanis, to check out the incredible coastline and the most epic mountains in the Arabian Peninsula, which go as high as 3,028m. 

Despite the modernization of the country, Oman has managed to preserve all its traditions and that is why, today, here you can still attend a livestock market and always share a meal with a local in the traditional way. 

Not surprisingly, Oman is getting immensely popular, but the good thing is that the country is big enough, so you can still find loads of off-the-beaten-track places that have remained untouched for centuries. 

Welcome to Oman.

🪪 How to get a visa for Oman

Most nationalities can buy an Oman tourist visa on arrival:

• 14-day visa : for free, no cost
• 30-day visa: 21 rials
• Multiple-entry visa, valid for 1 year: 50 rials

If possible, try to pay in either Omani Rials or with a credit card, because the price in USD is higher than the actual exchange rate. 

You can also buy your Omani visa online through this portal at a discounted price (around 1 rial), which is 2-3USD, for the 30-day visa at least. 

What nationalities are eligible for visa on arrival?

European Union, Andorra, Argentina, Australia, Bolivia, Brazil, Brunei, Canada, Chile, Colombia, Ecuador, Hong Kong, Iceland, Indonesia, Japan, Lebanon , Liechtenstein, Macau, Macedonia, Malaysia, Moldova , Monaco, New Zealand, Norway, Paraguay, San Marino, Seychelles, Singapore, South Africa, South Korea, Suriname, Taiwan, Thailand, Turkey, United States, Uruguay, Vatican City and Venezuela 

If you come from any other country, I suggest you check the e-visa portal . 

Do you have a UAE residence?

If you are not on the lucky countries list, but you are living and working in the United Arab Emirates, you may also be able to get a visa on arrival. However, you should check it with your own embassy.  

⛅ Best time to visit Oman

In Oman, there really isn’t a spring or autumn season but the weather just evolves from crazy hot to pleasant. Note that, depending on the year, May and October could still be really, really hot.

Traveling in Oman in summer – From May to October

• Pleasant weather in the high mountains
• Low-season prices
• Monsoon season in Salalah (South Oman)
• Unbearable heat across the country
• High levels of humidity in the coastal areas

Traveling in Oman in winter – From November to April

• Pleasant weather across the whole country
• Loads of social life, events, etc.
• Omanis are in their best mood
• Higher prices

🚑 Travel insurance for Oman

Hey, Oman is an adventure destination, a country where you may be camping in the wild, go trekking and do epic road trips, plus their health care system is private.

For this reason, I recommend IATI Insurance because:

• Covers all types of adventure activities
• Up to 5 million € of medical coverage
• Covers senior citizens too
• Readers of this blog can get a 5% exclusive discount

📚 Books for planning your trip to Oman

Oman travel guide by bradt.

The guide to Oman by Bradt is, definitely, the best guidebook about Oman that exists.

Arabian Peninsula travel guide by Lonely Planet

They also mention UAE and other Gulf countries but if you like collecting the LP or want to combine a few countries, this is also a good option. 

🛖 5 Top experiences in Oman

Some travelers may not agree with the below list, basically because they might not be part of the tourist trail, but having visited Oman extensively, getting quite off the beaten track, these are the must-try experiences worth to be featured in this Oman travel blog.

Traveling to Dubai? Read my complete 1-week itinerary to UAE for the independent traveler

1 – Experience the khareef season in Salalah

In Oman, there is a place full of green meadows, where it rains, and the locals sell locally-grown coconuts, pineapples, and papayas. This place is called Salalah, in southern Oman, a city that experiences a monsoon season called khareef , which takes place from July to September.

During this season, Salalah becomes beautiful and lush green, attracting visitors from all over the country, as well as Saudi Arabia and the UAE.

Check my ultimate guide to visit Salalah and the rest of Dhofar region

2 – Driving the coastal road from Salalah to the Yemeni border

Very few travelers visit this remote part of the country, which is a real shame, because the coast of Dhofar province is home to the most dramatic coastline in Oman, composed of lush green mountains which, at the same time, serve as vertiginous cliffs that directly drop to turquoise-blue waters.

A type of landscape you would never think of in the Arabian Peninsula. 

It looks like Hawai, right?

3 – Experiencing the Omani traditional life

What I like about Oman is that, unlike its neighbors from UAE, Qatar, Bahrain or Kuwait, it is a country with a complex, ancient history that managed to keep its traditions.

From livestock markets to artisan shops, actual Bedouins and historical mountain villages, the cultural experience in Oman is just as great as its epic landscapes. 

4 – Camping at one of the many wadis in Oman

Oman is about outdoors and since the country is not known for its nightlife, not even Muscat , both locals and expats tend to spend their weekends outdoors, especially camping in a wadi (valley) over a night barbecue.

If you want to join an Omani group, check the weekly events on Couchsurfing.

If you decide to go alone and go on a weekend, expect kind Omanis to tell you to join them.

5 – The historical heritage, from ruined cities to epic forts and abandoned villages

Despite being a mostly desert country, Oman has a fair amount of historical places to visit, ranging from well-restored, impressive forts, like the one in Rustaq, Nizwa or Bahla; to absolutely ruined historical cities like the barely visited one in Manah. 

Moreover, the mountains of Oman are also filled with abandoned villages that had been inhabited for centuries, but due to their inaccessibility, the Omani Government gave the villagers incentives to move to more accessible towns.

👨 Independent travel in Oman. Do you need to join a tour?

Oman is a difficult country to move around, basically, because you hardly find public transportation. 

Therefore, to travel in Oman, you need to either rent a car or go on a tour .

There is a third, more challenging way: hitchhiking – but we will get into that later. 

Below you can find a few examples but here I have put a compelling list: Best excursions, activities and day tours in Oman

Best Muscat City Tour

Muscat is full of amazing sites, but it is not very walking-friendly precisely. Joining a tour will definitely prove cheaper than hiring a taxi driver.

Best adventurous tour: Jebel Shams

The Grand Canyon of Oman is one of the most epic, natural places in the country, and it is easily visited from Muscat on a day trip.

Best cultural tour: Nizwa

One of the most historically important cities in Oman has a great souq and a beautiful fortress.

You may also like: the 10 best desert safaris in Dubai

⚠️ Is it safe to travel to Oman?

Oman is safe and, perhaps, the safest country in the Middle East , no kidding. 

Even the utterly negatively-exaggerated FCDO advice says that Oman is trouble-free. 

The fact is that Oman is one of those countries where crime is a rare thing to see.

Actually, a good friend of mine from southern Oman told me that since he was born 40 years ago, there is only been one murder in his province (Dhofar), and it was between foreign workers. 

How many people have been murdered in your province or city?

There are no pickpockets and nobody will mug you. Oman is very safe and terrorism is unheard of, especially because it has always kept away of all Middle Eastern conflicts. 

For a more comprehensive analysis, read: Is Oman safe?

20 Facts about Omanis and the country of Oman

1 – oman is an arab country and omanis are arabs.

It is one of the 22 countries that comprise the Arab League . 

2 – Many Omanis are ethnically from Zanzibar

From the 17th to the 19th century, the Sultanate of Oman was a major maritime force that controlled a large part of East Africa, Zanzibar being one of the most important territories.

When you travel in Oman, you will see a lot of very dark Omanis with strong East African features. Most likely, their ancestors come from Zanzibar but, culturally, they are 100% Omani. 

Read my city guide to Muscat!

3 – And then you have the Baluchis

Balochistan is a region spread across Pakistan, Iran, and Afghanistan and, for many years, the Baluch city of Gwadar (in today’s Pakistan) was under Omani rule. Baluchis were known for being fierce warriors and that is why, over the centuries, the Sultanate used them as loyal mercenaries to consolidate Oman’s power.

Today, a large population of Baluchis still remain in Oman (about half a million) and while they are considered 100% Omanis, many of them speak a distinct language which is close to Hindi or Urdu, and they have similarities with their South Asian neighbors. 

4 – But there are more groups

From the several Dhofari tribes in southern Oman (which are culturally closer to Yemen) to the Bedouins, Oman is ethnically rich. 

5 – South Asians make up around 45-55% of the total population

By South Asians, I mean people from Pakistan , India, and Bangladesh, especially Bangladesh, most of them being workers with low-qualified jobs. 

6 – Arabic is the official language

Omani Arabic is very similar to the one spoken in UAE, Saudi Arabia and the rest of the Gulf countries, with its own similarities, of course. They claim that the Arabic from the Gulf is the closest to Classical Arabic, the Arabic the Quran is written in.

7 – Other languages, however, are also spoken

I personally spent several days in Dhofar province, staying with a guy named Mussab in a small village north of Salalah . Mussab spoke Jabali (Shehri) , a language that sounded completely different from Arabic. He said that some old people from remoter villages in his region can’t speak Arabic, only Jabali. 

8 – Many educated Omanis speak English

Especially in Muscat but, in smaller cities and rural areas, communicating in English can be a problem sometimes. 

9 – Most Omanis are Sunni Muslims

There are small concentrations of Shias in Muscat and along the northern coast, but Sunni Islam is the prevalent religion. 

10 – And they are a very conservative society

Islam is the basic pillar for pretty much any Omani, including the young generation. I hung out with Omanis from all ages and social classes and I barely met anyone who didn’t pray 5 times a day. They are strong believers and most of their rules, habits, and laws are based on Islam. 

11 – Conservative, but tolerant with foreigners

In Oman, there aren’t specific rules dictating how you need to dress, and alcohol is widely available for foreigners. Women don’t need to cover up and, if you want to wear shorts, you just wear them. Omanis understand the cultural differences between themselves and Europeans, so you don’t need to explain anything to them. 

A piece of advice for women – When I was traveling in the touristic areas of Oman, I saw quite a few Western women dressing like they would do in a beach destination back home, and that was with very tight and small clothes. There isn’t really a law against that, and Omanis are the kindest people on Earth, so most likely, whatever you wear, they won’t say you anything to you because you are their guest. However, I certainly know that many Omanis get bothered when they see a woman dressing like that, especially in villages. Look, I know that I shouldn’t tell a woman what to do, but just bear in mind that you are in their country and, in order to enjoy their kindness and hospitality , showing your respect for their culture is a great start. You don’t need to cover your head or anything like that, but just try to dress more conservatively, and you will see that Omanis will receive you in open arms. For more information, read: Solo female travel in Oman

12 – Some of the most hospitable people ever

You may think this as a cliché statement, but it’s not. Omanis are in the top 3 of the most hospitable people I have ever met, along with Iranians and Pakistanis.

Over my backpacking journey, I lost count of all the house invitations I got, plus the kindness of the many locals I hitched a ride with, always willing to meet and help you, expecting nothing in return. 

13 – You will visit many guest rooms, but nothing beyond that

Omanis are very private. Families don’t really like people entering their houses, especially because it is the only place where their women can roam around freely.

For this reason, all houses tend to have a guest room, which is a living room attached to the main entrance of the house. If you are a man, you won’t be allowed to cross that room but, in that room, you will be treated like a royal guest. 

14 – About local women

Yes, Oman is a conservative Muslim society and as such, women have fewer rights than men but still, they are much further ahead than Saudi Arabia , especially when it comes to high education and public jobs, and you will hardly see any women wearing the niqab .

However, you won’t really see women socializing alone in the street and, as a man, you will hardly talk to any of them. 

Read: 9 Misconceptions about traveling as a female in Saudi

15 – Expect to see many pictures from Saddam Hussein

I traveled around Oman always hitchhiking and, during my journey, I got lifts from many people who had Saddam Hussein’s photo hanging from the rear mirror. 

Read: Iraqi Kurdistan travel guide

16 – Get used to shopping from the car

Omanis have a strange custom which is that they don’t like to get out of their car when they go to the grocery store or want to take away food. Instead, they stop at the entrance and beep like crazy until a poor Bengali comes out asking for their order.

A strange custom which I never managed to get used to. 

17 – They even have drive-thru ATMs

When I was at the gas station of Salalah, for the first time in my life, I saw a drive-thru ATM, which was also located right next to a few normal ATMs.

The shocking fact was that there were 3-4 cars standing on the line, yet, the normal ATMs were empty, which meant that they preferred waiting to getting out of the car – and it wasn’t due to the heat because it was during winter. 

18 – The strangest signboards for shops

”Fish Marketing”, ”Food Stuff”, or ”Café that offers meals mainly”, among the most classic ones.  

19 – Sultan Qaboos is the most beloved leader in the world

There isn’t a single Omani who doesn’t love their leader and the reason is that he has made their country great, not only when it comes to giving free stuff to its citizens – like houses – but he introduced a bunch of liberal laws (like freedom of religion) which his dictatorial predecessor didn’t allow.

Sultan Qaboos passed away in January 2020 at the age of 79. May him rest in peace

20 – What you need to know about camels

In Oman there are a lot of camels, but most of them are concentrated in the south, in Dhofar province (the north is more about goats). Dhofar is perhaps, the place with the largest concentration of camels in the world, no kidding.

They are absolutely everywhere, like sleeping in the middle of the road and stuff like that. Unfortunately, most of them will end up their days in a butchery.

Tales of Omani hospitality I wish I had space here to tell you all the stories of hospitality and kindness I had with the tens of Omanis I hung out with. As I told you before, I traveled in Oman completely by hitchhiking, camped in the middle of towns and cities, and did a lot of Couchsurfing. When you are backpacking this way, the local interactions are non-stop and in most cases, Omanis just tried to be overwhelmingly helpful. I got invited to have coffee to countless houses, they took me out for lunch and dinner every other day and, on many occasions, the people I hitched a ride with, always insisted on driving me to my exact location, even if that required them to make a huge detour. For this reason, I strongly recommend you travel in Oman independently , not on a tour.

🍲 Food and coffee in Oman

Honestly, food isn’t the highlight of any Oman trip, but there are some surprises and interesting facts. 

The first thing you need to know is that Omani cuisine is very limited, as it mainly consists of meat or fish with rice , served in ridiculously massive portions. 

Camel meat is eaten all across the country but nowhere like in Dhofar province, the place with perhaps, the largest concentration of camels in the world. In Salalah and around , camel meat is eaten very regularly in most restaurants, usually grilled, but you also find camel shawarmas , burgers and stuff like that. 

Besides rice with its respective portion of protein, you may also find shurbah , a local soup made of oatmeal, tomatoes, and other vegetables. 

That’s it pretty much when it comes to Omani food but, one day when I was Sadeh, a coastal village 2 hours north of Salalah, my host wanted me to eat a very special dish from his region. 

And what are we gonna eat?  – I asked

He didn’t know the name in English, so he Googled it and said: It’s called oysters. My friend catches them. 

I thought we would be eating oysters in the same way we eat them back home but instead, he brought a massive dish of oysters without shells, cooked in a spicy sauce, but they still preserved the strong sea taste oysters usually have.

That dish was, definitely, one of the best dishes I ever had traveling, if not the best .

On the other hand, due to the big Indian influence, you also find loads and loads of restaurants – even in the smallest villages – serving all kinds of Indian food , ranging from daal to fish curries, and even calamari masala, always very cheap. Daal was usually my everyday breakfast. 

Here are some facts about eating when you travel in Oman:

• Typically, you will eat on the floor, with a plastic tablecloth
• Usually, everything will be served on one single plate, even if you are several people, and you will eat from the same plate.
• You eat with your hands, and no plates or forks are provided. 
• Guests are not supposed to leave any food – That was hard because of the XXL portions
• In rural areas, you should eat with your right hand and doing otherwise is considered rude – This rule applies in all Muslim countries but Oman is particularly conservative and, along with Saudi Arabia, it is the only country where, on several occasions, the locals told me I was doing it wrong  (I am left-handed).

What you need to know about kahwa

Kahwa is the local coffee from the Arabian Peninsula, consisting of regular coffee with cardamom, served in a traditional pot. 

The problem with kahwa is that if you travel in Oman independently and have a lot of local interactions, you will be offered this coffee several times a day, meaning that you will have a shit load of cups, therefore, your heart rate is likely to increase.

When I was hitchhiking in Central Oman, where tourists are rare, one day I had to have more than 25 cups of kahwa – no kidding – as you are supposed to have at least a few when you are offered. 

If you are in a house, kahwa will be typically served with dates and if you are lucky, with tajin as well, a kind of sauce in which you dip your dates.

In fancier occasions, they will serve it with halwa , a traditional sticky, jelly-like dessert made of wheat starch, eggs, saffron, cardamom, nuts, and A LOT of sugar. It’s a bomb. 

What to do with all the dates

Of course, dates are immensely popular in Oman, especially in the north, and they claim that dates from Nizwa are the very best. Every time I stayed with an Omani from the north, they gifted me with a crazy bag loaded with dates, and they were so heavy.

Since I couldn’t finish them all, they were piling up, so every time I hitched a ride with a foreigner, I also gave them dates.

💻 Internet and connectivity in Oman

Wi-Fi – Wi-Fi usually works great but, unfortunately, it is difficult to find a Wi-Fi network, as the internet is expensive in Oman, so only hotels and Western-style cafés can afford it. So, when you are traveling in rural Oman, getting connected may prove challenging.

Moreover, Wi-Fi networks tend to require a local Omani number in order to connect, so you will have to buy a SIM Card anyways. 

SIM Card – SIM Cards in Oman are expensive as well. Omantel is the most popular one. They offer an entry plan which may be enough for short-term stays but then, if you are planning to travel to Oman for several weeks, the price per GB is pricey, like 8-9USD for 1GB worth of data. 

eSIM for browsing, calling and traveling in Oman

Basically, an eSIM is a regular SIM card with a digital format that works like a normal physical SIM card, with the added benefit that you can buy it from home before the beginning of your trip, hence avoiding the hassle of buying it at your destination. 

With Holafly , you can get a SIM Card for a wide range of destinations, including Oman . 

Moreover, you can benefit from a 5% discount with the following code:  AGAINSTTHECOMPASS

Get a VPN for traveling in Oman

You should always use a VPN when you travel, especially when you connect to public Wi-Fi networks.

Your connection will be much safer. 

Moreover, you will be able to access content which is typically censored in Oman. 

I recommend ExpressVPN – Extremely easy to use, fast and cheap. 

If you want to learn more about VPN, check: Why you need a VPN for traveling .

💰 Money & budgeting when you travel in Oman

In Oman, they use the Omani Rial (OR) and approximately:

1 USD = 0.39 OMR

Yes, it is worth more than 2USD. 

Omani Rials are split into baisas (bzs) and 1OMR = 1,000bzs

The Omani Rial is a stable currency. 

Exchanging money in Oman

Given the fact that half of the population are foreigners, money exchange offices abound. 

Plenty of ATMs everywhere

Credit cards

In local eateries, taxis, small shops, budget hotels etc. you must pay in cash, so always bring plenty of it. 

How much does traveling to Oman cost?

All right, Oman is an expensive destination (yeah, really), for two reasons:

• There is no public transportation
• There aren’t budget hotels

How much you will spend when traveling in Oman is hard to say, as it will depend on several factors.

For example, I have never spent much because, during my first 6 or 7 visits, I always came with my own car and used to camp in the wadis or the beach and, on my last occasion, I was purely hitchhiking and Couchsurfing, so I barely spent 20USD a day. 

Local food is actually cheap but, if you rent a car and stay in hotels, costs will add up significantly. 

Here are the typical prices of the most basic stuff:

• One-month visa –  20OMR
• Welcome package SIM + Data –  3OMR but then you pay 3OMR for 1GB
• The most budget hotel –  10-12OMR
• A plate of daal – 500bzs
• A biryani –  1.5OMR
• A big bottle of water – 200bzs
• A beer – 4OMR
• Short taxi rides within Muscat –  2.50OMR
• Bus from Muscat to Salalah –  7OMR

How to travel in Oman on a super budget:

• Do hitchhike (it is fairly easy)
• Do Couchsurfing
• Only eat in Indian-run restaurants
• Go to the mountains and camp outdoors
• Sign up for Couchsurfing events and join weekend trips

If you want to know more, read my guide on how to go backpacking in Oman on a super budget

🛺 Transportation tips – How to move around Oman

• Regular taxi – If you don’t have a car, taxis are the way to go in Muscat. They don’t have taximeters, however, and taxi drivers from Muscat are really annoying because they always try to rip off tourists. I recommend using Careem or Uber.
• Bus – There are a few bus lines in Muscat that go all the way to Ruwi from the airport. They cost 500bzs. For more information, read my Muscat City Guide . 

Renting a car in Oman

To be very honest, Oman is a country that is best explored by car, as the vast majority of its places are completely inaccessible.

A car will make your life much easier, plus you will be able to find epic camping spots and just have a lot of freedom.

I recommend you find your car via Rental Cars, a search engine that helps you find the best deals, no matter where you are.

Do you need a 4×4 for your trip to Oman?

Before making this decision, you need to think: where are you going to go?

The roads in Oman are generally good and the only 2 places I went where a 4×4 was needed were Jebel Akhdar and the road from Al Hamra to Rustaq via Bald Sayt. 

Then, you have the Empty Quarter but, even if you had the best 4×4, it is not recommended to go without an experienced driver – The dunes in the Empty Quarter are a few hundred meters high, and they are shifting sands. 

Unless you really want to drive off-road , bear in mind that renting a 4×4 is much more expensive than a regular car, so you really need to assess whether it is worth to pay the extra money for being able to go to Jebel Akhdar and Bald Sayt. 

Traveling around Oman by bus

Traveling in Oman by bus sucks, for 3 reasons:

• They just go to the main cities and towns
• There are only a few a day
• Cities in Oman are not walking-friendly, so when you get to a city by bus, you are screwed again.

Going by bus isn’t a good option for traveling in Oman. 

Hitchhiking in Oman

The best option for budget backpackers. 

Hitchhiking in Oman is super easy. I hitchhiked more than 1400km, from Salalah to Muscat and everything in between, and never had to wait much.

For more information, read my budget backpacking guide in Oman .

🛫 How to get to Oman

Traveling to oman by air.

Today, there are many international connections coming from different European and Asian cities to Muscat . However, flying to Dubai will always be cheaper, so I recommend you check both and then you decide.

The southern city of Salalah also has an international airport, with connections from other Arab countries, India, Pakistan , etc.

Traveling to Oman by land

Oman shares a border with UAE, Yemen , and Saudi Arabia.

• UAE – Traveling from Dubai to Muscat is a 400km drive. You can come by car but there are also buses from Bur Dubai. Check here for more info . 
• Saudi –  Apparently, the border was recently opened, but there are no buses and it is actually faster going through UAE, which would be a 1,300km drive from  Riyadh  to Muscat. Read my  travel guide to Saudi Arabia . 
• Yemen – The border is open but it is a very long drive. For more information on visiting Yemen, read this post . 

🏨 Accommodation tips – Which kind of accommodation do you have?

Check my comprehensive guide on how to find the right accommodation in Muscat

The first thing you need to know is that in Oman there aren’t hostels or guest houses, only hotels.

Budget Hotels

Only available in big cities and on roads. You pay 25-30USD for a single room but on the bright side, the few I stayed in tended to be clean and have some minimum standards. 

Hotel-apartments

In big cities, you can also find hotel apartments, which are very good value-for-money if you are more than 2 people.

Mid-range hotels

In rural touristic places such as Jebel Shams, Jebel Akhdar, villages like Bald Sayt, etc. there aren’t budget hotels and rates may easily start at 100USD per night. 

5-star hotels

The offer of luxury hotels in Oman is very large. 

Couchsurfing

Plenty of profiles but I recommend you send the requests in advance because Omanis tend to take a while to reply.

❗ More information to add up to this Oman travel guide

📢 In my Travel Resources Page you can find the list of all the sites and services I use to book hotels, tours, travel insurance and more.

All guides and articles for traveling in Oman destination

• Travel Guide to Musandam
• Muscat Travel Guide
• Where to Stay in Muscat
• Best Activities, Tours and Excursion in Oman
• A City Guide to Salalah Dhofar
• Oman Budget Guide
• Solo Female Travel Guide to Oman
• Is Oman Safe?

Travel guides to other countries in the Middle East

• Iran Travel Guide
• Palestine Travel Guide
• Syria Travel Guide
• Travel Guide to Lebanon
• Iraq Travel Guide
• Travel Guide to Saudi Arabia
• Yemen Travel Guide

You will also be interested in: Where in the Middle East is safe? and The most beautiful places in the Middle East .

This Oman travel guide contained everything you needed to know for your trip. If you have any additional information or questions, kindly post them in the comments section

22 comments

Great article – very useful and informative. Thanks!

Thank you very much, the article is very helpful und interesting!

Just wanted to comment on correcting one fact Oman is the only country that the majority of muslims are Ibadi, not Sunni.

thanks, Ali!

Hey Joan, great source of info, really well written and love all the cultural information. We want to rent a car for traveling around Oman. Is it easy to find camping gear in Muscat? Any shop you can recommend?

Hey there, thx for all the information, do you know if it is possible for EU citizens to get a 10-day visa on the border when coming by bus from Dubai?

If coming by land, I recommend you buy it online beforehand.

Hi, have you got any direct contact details (phone, email) for Fort Guesthouse in Muscat? Thanks, love your stuff, Terry

Thanks so much for all this info! I recently returned from a trip to Oman and used this (along with a lot of your others posts) for help and information 🙂

thank you 🙂

Hi, Can someone advise me on the best currency to use when holidaying in Oman please? Rials or USdollars? TIA

In Oman, they use Omani Rials

Love your work, I have been reading it extensively. We have accidently booked our 4 days in Oman next year during Eid al-Adha. Do you know how this may negatively affect our time there? Ie. can we still rent a car and travel easily?

Hi Richard, it’s really not a problem, other than it will be busy, since many expats in UAE decide to travel to Oman during these dates.

About visa, most of nationalities doesn’t need visa for 14 days or less if they arrive by airplane. Visa for 14 days on land border crossings is not valid/avaliable anymore, nor it is possible to buy it through official government website.

I can send you screenshot from government official email on my request about that matter as proof if you need. 🙂

Thank you for the information, Peter.

Great Article , can u recommend any good hassel free car hire company .

none in particular, I always check on Rental Cars

Such a nice summary!! We originally planned to go with a travel agency but at the end we might rather go on our own with more freedom to travel where we want. Thank you so much for these tips! I learned all I needed to know! Love from Lucy form Prague

Have a fun and safe trip!

Greetings, Joan! Inspired by you (and a few others), I’m visiting Oman for 24 days. Can you suggest a site where I might find a travel partner to split a vehicle? Many thanks–I’m a big fan1

Maybe in Facebook group Overlanding in the Middle East

Leave a Comment Cancel reply

Your email address will not be published. Required fields are marked *

  Notify me when new comments are added.

Join our Expeditions

From Syria to Iraq in Pakistan, Against the Compass is finally running expeditions to the most epic and off-the-beaten-track countries.

We have scheduled expeditions for every month of the year.

Latest posts

• Backpacking Venezuela Travel Guide (2024)
• How to travel to Afghanistan during Taliban rule (2024)
• How to visit Los Llanos in Venezuela
• How to visit Angel Falls and Canaima National Park
• Things to do in Haiti in a 1-week itinerary

• Credit Limit Credit Limit Used Available USD Points Redeem 0 Pts Future Points 0 Pts Redeem Now 0) --> Deposit Deposit Limit Used Available

In partnership with

• Have an Acoount? LOGIN
• Create Account Sign UP

Not a member yet? Sign up

Please provide your detail.

We'll send password reset instructions to the email address associated with your account.

Back to Sign in or Sign up

Already a member? Sign in

View, print, or cancel your booking without signing in

A Gift for life

Embark on a transformative journey through Oman, where discovery unveils hidden stories, wonder awakens the senses and exhilaration ignites the spirit, explore the ‘Gift for Life’ right here in Oman.

Exhilaration

Click below for more travel tips and inspiration

Notification

• Nous écrire

• Voyages Oman

Circuits et Voyages à Oman

Perle de l'Orient aux mille couleurs

98.6% de satisfaction client

Julien Erster

Créateur des voyages à Oman

Contactez un conseiller

04 79 33 76 33 |

021 566 74 91 |

6 voyages disponibles Filtrer

Voir  6   voyages Réinitialiser

Nos voyages en groupe

Ajouter à mes préférés

Ajouté aux préférés

• Oman OM 701
• 4 à 12 personnes

Grand Tour d’Oman

• Une découverte complète du pays combinée à de nombreuses randos
• La variété des lieux visités, entre montagnes, déserts et littoral
• Une immersion dans les Sugar Dunes, d'un blanc immaculé
• L’alternance des nuitées en bivouac, hôtel et bungalow

• Oman OM 601

Trésors d’Oman

• Un kaléidoscope de paysages et d’ambiances révélant les attraits du sultanat
• Des balades à pied accessibles à tous et réparties tout au long du voyage
• La touche culturelle : musée national, forts de Jabreen et Nizwa...
• Le confort des hébergements : gîte, hôtel, campement fixe dans le désert
• Oman OM 203

Montagnes, Dunes et Canyon

• Un trek de 4 jours dans les montagnes avec des étapes aussi belles que variées
• Une immersion dans les dunes du Wahiba
• L’intégrale du canyon Wadi Bani Khalid, une rando aquatique exceptionnelle
• Des transferts limités et optimisés
• Oman OM 202

Trek à Oman, entre Montagnes et Wadis

• Programme sportif avec les plus belles randos dans les montagnes omanaises
• 2 superbes treks dont une traversée méconnue du Djebel Akhdar
• Des randonnées aquatiques dans de splendides canyons
• L’alternance des nuits en bivouac, hôtel et guesthouse de montagne
• Oman OM 703
• 5 à 12 personnes

Oman, du Dhofar aux Fjords du Musandam

• Une grande traversée originale sud-nord en 3 semaines
• Les classiques d'Oman et des lieux plus secrets : Dhofar, Rub Al Khali, Musandam
• Deux jours de visite guidée à Dubaï, l'émirat des superlatifs !
• Un voyage en pension complète (sauf 2 repas libres à Dubaï)
• Oman OM 702

Dhofar, du Désert du Rub al Khali à l'Océan Indien

• La magnifique région isolée du Dhofar, sur les routes antiques de l'encens
• L'Arabie Verte du littoral et l'aridité du désert en un voyage
• L'ascension des plus hautes dunes du Rub al Khali, le désert des déserts !
• L’alternance des nuits en bivouac et hôtels confortables en bord de mer

Découvrez Oman, une perle de l’Orient

Dans la Péninsule arabique, le Sultanat d’Oman est une terre de paix baignée par la mer d’Arabie et le golfe d’Oman, où la route de l’encens mène les visiteurs vers le désert et les chaînes de montagnes. Un pays pluriel surnommé – à juste titre – le secret le mieux gardé d’Orient.

Oman un pays aux mille couleurs

Véritable trait d’union entre l’Afrique et l’Inde, Oman est un pays de 4 millions d’habitants où l’azur de l’océan Indien succède à la blondeur des dunes et au vert des wadis qui alimentent de luxuriantes oasis. C’est une terre traversée par l’ancienne « route de l’encens », où un circuit peut subjuguer les visiteurs amoureux de randonnées dans le désert, de treks en montagne comme de plongée sous-marine. Le sultanat, riche d’une histoire de 5 000 ans, abrite également un remarquable patrimoine culturel, avec des sites classés au patrimoine mondial de l’Unesco comme le fort de Bahia ou les sites archéologiques de Bat, Al-Khutm et Al-Ayn. N’oublions pas de faire étape dans la capitale, Mascate, pour y admirer, notamment, la vieille ville et le palais royal.

Des circuits entre côtes sauvages et déserts secrets

Les circuits à Oman offrent de multiples possibilités aux visiteurs avides de belles découvertes. Amateurs de culture comme passionnés de trek trouvent ici leur bonheur pour un séjour toujours inoubliable. Tirawa vous emmène faire le tour d’Oman : du bord de mer au Grand Canyon d’Arabie, du désert blanc aux villages reculés de montagne, profitez de la diversité du sultanat. Les aventuriers peuvent opter pour une traversée nord-sud, entre détroit d’Ormuz et grand désert d’Arabie, ou bien pour un trek au pays de l’encens, dans la région du Dhofar et ses trésors antiques. Si Trésors d’Oman est un circuit confort, les plus sportifs préféreront un trek de deux semaines avec au programme des randonnées en montagne, des incursions dans les dunes et les canyons et, finalement, la découverte du littoral. Dans tous les cas, des rencontres inoubliables, au plus près de la nature et des populations, attendent les visiteurs du sultanat.

Savoir faire et expertise

Des voyages élaborés sur le terrain

Indépendant et responsable

Un tour opérateur à taille humaine

Qualité au juste prix

Des prestations soignées

Petits groupes

Voyage enrichissant et convivial !

Guides experts

Vous êtes en bonne compagnie

Avis voyageurs

Des témoignages en toute confiance

Écrivez-nous

Nos équipes vous accompagnent pour le choix d'un voyage et répondent à vos questions.

Nous joindre par téléphone

Vous pouvez nous joindre par téléphone aux horaires d'ouverture de nos agences .

Tirawa France

04 79 33 76 33

Tirawa Suisse

021 566 74 91

Signaler un avis

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• All Inclusive Offers
• Athens Vacations
• Early bird offers
• Dubai Vacations
• Last Minute Escapes

Maldives Vacations

• Milan Vacations
• Upgrades & More

Featured Destinations

Middle east.

• Ras Al Khaimah

Indian Ocean

• Philippines
• South Korea
• South Africa
• All-Inclusive Vacations
• Beach Vacations
• Business Class Vacations
• Family Vacations
• Ultimate Luxury
• Wellness Vacations
• Egypt - Splendours of the Nile
• India - Golden Triangle Tour
• Italy - Milan and Lake Como
• Jordan - Jordan Explorer Tour
• South East Asia
• Sri Lanka - Serendib Explorer
• COVID-19 Hub
• Pay My Balance
• 1-855-358-1505
• Flight + Hotel

Search Holidays

• Manage My Booking

Oman Vacations

Introduction, at a glance, when to visit, what to pack, areas of oman.

From off-road adventures in its majestic mountains and desert camping under the stars, a vacation in Oman is an undiscovered treasure. Whether you're hoping to spot dolphins off the shore or embrace the buzz of the growing capital city Muscat, Oman offers an authentic and friendly Arabian experience. Look forward to the vacation of a lifetime.

Emirates gateway: Muscat Seeb International Airport

Time zone: GMT +4 hours

Currency: Omani Rial (OMR). It's best to order currency in before travelling. There are ATMs in major cities and credit cards are accepted

Languages: Arabic is the offcial language. English is widely spoken and Swahili is spoken by Omanis decended from East Africa

Dialing code: +968

Religion: Islam

Plug sockets: Electricity supply is 240v, 50Hz AC. You will frequently see the UK-style three-pin, but often a two-pin socket, so an international adaptor is recommended, in case of variations

Dubai Airport to Musandam: 120 minutes

Muscat Airport to city centre: 20 minutes

Muscat Airport to Shangri-La/Al Bustan: 45 minutes

Known for its warm hospitality, Oman is a fascinating country, with ancient traditions, a rich history and vast natural beauty.

• With five of the world's species of sea turtle coming here to nest, spotting them along Oman's coast is a charming highlight.
• Visit Jebel Shams, the country's highest peak and incredible Wadi Ghul, a gorge that rivals the Grand Canyon in scale.
• Take a 4WD tour of Wahiba Sands, watch the sun setting over dramatic sand dunes and camp under the stars in this incredibly diverse desert region.
• Wander the streets, souks and shorelines of Muscat, one of the most charming capitals of the Arabian Peninsula.

October to April is the most pleasant time to visit. In summer, expect humid conditions at the coast but a dry heat further inland. From May to September, the southern Dhofar region is uniquely transformed by the khareef, a monsoon that turns everything green and brings lower temperatures.

Light cotton clothing is prudent, and when touring, safari-type attire is a good idea given the desert dust. Oman is a Muslim country, so women should dress respectfully; keep a Pashmina-style scarf handy in case you need to cover your hair and shoulders.

People-watch along the Corniche as you sip an Omani coffee, stroll along the city's public beach, or be awed by the Sultan Qaboos Grand Mosque. Visit the impressive new Royal Opera House, either catching a performance, or taking a tour, before shopping in the luxury mall next door. If you prefer more affordable shopping, a friendly haggle at the Muttrah Souk is a must, as you shop for gold, silver, frankincense and spices, or perhaps an embroidered kuma, the hats worn by local Omani men.

This exclave is at the far northern tip of the Arabian Peninsula, jutting into the Straight of Hormuz, a strategically important but narrow entry point into the Persian Gulf. It is separated from the rest of Oman by the United Arab Emirates and its differentiated geology sees it referred to as "the Norway of Arabia" thanks to its clear-watered fjord-like inlets, or khors; taking a dolphin-spotting dhow tour from the regional capital, Khasab, is a popular activity too. Diving, and rock climbing are particularly good here.

This province in the south-west benefits from the khareef, a monsoon that travels across from India from June to August creating an oasis and cooler temperatures that attract tourists from around the Gulf. Its palm-fringed beaches have several high-quality hotels and Salalah, the main city, can be by flights from Muscat. Take a dhow cruise, explore the frankincense trail, or go on a 4WD safari in to world's largest sand desert - the Rub' al-Khali, or Empty Quarter - which flows from Salalah towards Saudi Arabia.

Nizwa and Jebel Shams

Head out of Muscat through the Hajar mountains that dominate the skyline and within two hours you will be in former capital Nizwa, with its huge 17th-century fort, the stronghold of the imams who once ruled central Oman. Once you've explored the fort, shopping in the souks is inevitable and Nizwa's don't disappoint. The usual combination with Nizwa is to head onwards past verdant date plantations to the country's highest peak, Jebel Shams at 3,000 metres, and the mighty Wadi Ghul, known as "the Grand Canyon" of Oman.

Ras al Jinz

Found at the eastern-most point of the Arabian peninsula, this popular spot for turtles is about three hours' drive from Muscat. The Ras al Jinz reserve was formed in 1996 and each year welcomes up to 20,000 turtles from around the Arabian Gulf and the Red Sea; five of the seven species of sea turtle can often be seen, the the most commonly spotted one of the Green Turtle.

Expect flavoursome stews, curries and soups, succulent kebabs, fragrant saffron or lemon rice, marinated meat cooked slowly in underground clay ovens and incredible fish straight from the Arabian Sea. As an act of hospitality, you are often likely to be offered kahwa - strong coffee mixed with cardamom powder - served with dates.

Omanis are fiercely proud of their country and of their leader Sultan Qaboos bin Said Al Said, who has ruled since 1970 and whose portrait can be seen almost everywhere you go. Traditions and customs are heartily preserved in this conservative country, but it's also worth noting that Oman has always been one of the more outward looking of the Arab nations.

A small number of endangered Arabian Leopard live in the Jebel Samhan Nature Reserve in the southern Dhofar region. One of the most iconic creatures of Arabia, the oryx, can also be found in Oman, but this graceful antelope is at risk too. Camels are prevalent of course, and birdlife here is fascinating, from the critically endangered subspecies of little White-collared Kingfisher to soaring eagles. Oman's marine diversity includes a population of non-migratory humpback whales, plenty of dolphins and several breeds of turtle.

There's evidence of life in Oman as far back as 100,000 years, and the region was part of the Persian Achaemenid Empire in the 6th century BC. Oman later followed the lead of Persia and converted to Islam in the 7th century. The Portuguese took Muscat in the early 16th century and many of the 500 forts in the country were built around this time. Portugal dominated Oman's valuable coastline for 150 years, but by the end of the 18th century, Oman had become a major trading empire in its own right, ruling Mombasa and Zanzibar. Oman was also a British protectorate from 1891 through to the 1950s. Sultan Qaboos bin Said al Said came to power in a bloodless coup in 1970 and embarked on a period of political, economic and industrial reform that continues today.

Explore more Indian Ocean Holidays

Mauritius Vacations

Seychelles Vacations

Sri Lanka Vacations

Join the emirates vacations community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Vacations?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

Préparer son voyage à Oman : 20 conseils & astuces à connaitre

En pleine préparation de votre voyage dans le Sultanat d'Oman ? Je vous donne 20 conseils & astuces qui vont vous aider à préparer au mieux votre voyage. Un article à lire absolument avant votre départ !

• Si vous cherchez des infos sur les plus beaux endroits d'Oman, c'est ici .
• Besoin d'un itinéraire road-trip de 2 semaines qui vous permet de découvrir les incontournables mais aussi des pépites hors des sentiers battus ? C'est par là !
• A la recherche des plus beaux wadis omanais ? J'en parle dans cet article .
• Pour découvrir mes stories à la une sur Oman, cliquez ici .
• Et pour tous mes posts sur Oman, rendez-vous sur mon compte instagram .

Voilà une liste de bons plans que j'utilise lors de mes voyages et que partage dans chacun de mes articles pour t'aider à voyager sans te ruiner :

• Utilise une carte Bancaire sans frais à l'étranger et 100% gratuite, comme la carte Boursorama ULTIM . En plus, avec mon code parrainage CLLO7631 tu peux avoir jusqu'à 130€ offerts à l'ouverture de ton compte.
• Prends une carte e-sim Holafly pour éviter le hors forfait. Tu peux choisir en ligne la durée, le nombre de gigas et le pays couvert, et tout se fait automatiquement (tu reçois un code à insérer dans ton téléphone et la e-sim s'activera quand tu arriveras dans le pays). Avec mon code CLAIREXPLORE tu peux bénéficier de -5% sur ta carte e-sim.
• Réserve tes voyages à l'avance en utilisant la plateforme de réservation la plus complète du marché qui te permet d'avoir des avantages exclusifs (petit-déjeuner offert, surclassement offert, réduction sur le prix de la chambre...)
• Utilise une gourde filtrante Humagreen pour éviter d'acheter des bouteilles d'eau sans tomber malade. Avec mon code CLAIREXPLORE15 tu as -15% sur ta gourde filtrante.
• Réserve des free tours pour bénéficier de visites guidée gratuites par des locaux et réserve tes activités en avance pour bénéficier du meilleur prix
• Achète à l'avance les accessoires dont tu as besoin au meilleur prix pour éviter d'acheter sur place (à lire : 25 accessoires indispensables qui vont changer ton voyage )
• Utilise le meilleur comparateur pour tes différents trajets que ce soit pour l'avion , la location de voiture ou tes trajets en bus .

1/ Prévoyez un sac étanche & une pochette pour le portable dans les wadis

Les wadis sont des lits de rivières nichés au coeur des montagnes avec des bassins naturels dans lesquels on peut se baigner dans une eau à 27 degrés entourée d'une une végétation luxuriante. Ce sont des petits coins de paradis qui font la beauté et la spécificité d'Oman, ils seront sans nul doute sur votre itinéraire omanais.

Cependant plusieurs wadis nécessitent de laisser ses affaires sur un rocher afin de pouvoir pénétrer dans le wadi et en profiter pleinement. Si vous avez des biens personnels (téléphone portable, clés de voiture, portefeuille...) je comprends totalement que vous ne souhaitiez pas laisser vos affaires sans surveillance. Ainsi je vous conseille de prendre un sac étanche (comme celui-ci ), doublé d'une protection étanche pour votre téléphone portable , ce qui vous permettra d'explorer le wadi tout en emportant vos affaires précieuses avec vous.

A lire : mon article sur les plus beaux wadis d'Oman .

2/ Amenez un adaptateur car les prises ne sont pas les mêmes qu'en France

Les prises électriques sont comme en Angleterre (3 fiches), pensez à prendre un adaptateur ( de ce type ) afin de pouvoir charger vos appareils électroniques. Pensez également à prendre une multi-prise pour brancher plusieurs appareils en même temps !

A lire : mon article sur les 25 accessoires indispensables à emporter en voyage

3/ Habillez-vous convenablement pour un pays musulman

Oman est un pays musulman il est important de respecte les moeurs locales, et de se vêtir convenablement : exit donc les bikinis, les décolletés plongeants ou les mini-jupes lorsqu'il y a des locaux. Ainsi, privilégiez les pantalons ou robes longues lorsque vous vous baladez, sinon vous risquez de vous faire dévisager par les locaux, voire même de vous prendre quelques réflexion. Au-delà de ça, c'est surtout une question de respect. Pensez à prendre un foulard dans votre sac, qui peut parfaitement faire l’affaire sur un débardeur ou une robe sans manche, à ajuster en fonction des situations.

De la même façon, lorsque vous vous baignez dans les endroits fréquentés par les locaux, essayez d'avoir au minimum un lycra ( comme celui-ci ) ou un t-shirt classique (moins confortable mais fait l'affaire si vous ne voulez pas investir), et si possible un petit short de sport. Dans le Wadi Bani Khalid, une personne surveille les tenues et ils sont assez stricts là-dessus. En revanche, dans beaucoup d'endroits, comme notamment sur les îles Daymaniat ou dans le Wadi damm, nous n'avons croisé personne ou alors un ou deux touristes, dans ce cas-là j'ai enlevé mon t-shirt pour ne garder que mon maillot de bain. Tout est une question de bon sens et d'environnement. Dans les hôtels de luxe, il est parfaitement accepté de se baigner en bikini et de se promener avec des tenues occidentales.

A noter que dans les mosquées, il faut même se couvrir les chevilles, épaules et poignets, sans quoi vous ne pouvez pas rentrer à l'intérieur. Il faut également se couvrir les cheveux. Pensez à prendre une tenue adéquate : personnellement j'ai du ruser en rentrant une robe manche longue (mais courte) dans un pantalon long, avec une étole que je mets habituellement sur mes épaules avec mes tenues sans manche, sur ma tête pour me couvrir les cheveux.

4/ Achetez une carte SIM à l’aéroport

Je vous conseille de prendre une carte e-sim avec Holafly . L'avantage est double : vous pouvez la prendre avant d'arriver afin qu'elle soit active au moment où vous posez le pied dans le pays et vous pouvez conservez votre carte SIM française dans votre portable tout en ayant accès à la carte e-SIM. En effet, lorsque vous achetez la e-sim, vous recevez un code à insérer dans votre téléphone et la e-sim s'activera dès que vous atterrirez dans le pays. C'est super pratique et ça permet d'avoir internet dès son arrivée dans le nouveau pays ! Avec mon code CLAIREXPLORE vous pouvez bénéficier de -5% sur votre achat de carte e-sim.

Vous pouvez également acheter une carte SIM locale afin d'avoir accès à internet. Dans le hall de l'aéroport, il y a plusieurs fournisseurs, de notre côté nous sommes allés au stand Oredoo qui propose deux cartes prépayées intéressantes :

• 4 Giga : 7 OMR (environ 18€)
• 10 Giga : 15 OMR (environ 38€) Il y a également une vingtaine de minutes d'appels locaux compris, ce qui peut toujours être utile.

Désactivez les données à l'étranger avant votre vol et n'imaginez même pas vous connecter avec votre forfait français : les prix sont exorbitants (environ 10€/Mo)

Avoir une carte prépayée à Oman vous sera très utile pour trouver votre hôtel, un restaurant, un wadi ou tout simplement utiliser le GPS pour vous rendre d'un point à un autre. Aussi, il n'y a pas la wifi partout, sauf dans les grands hôtels, donc si vous souhaitez aller sur internet le soir dans votre chambre, il est préférable d'avoir une carte sim avec la 4G.

Attention, il n’y a pas du réseau partout alors pensez à télécharger les cartes hors connexion pour le GPS via Google Maps.

5/ Evitez la période du Ramadan

La période du Ramadan et à éviter car tout s'arrête dans la journée et la vie tourne au ralenti. Les petits restaurants locaux (en dehors des hôtels de luxe), boutiques, souks, banques,... sont fermés et n'ouvrent qu'à la tombée de la nuit. Même si vous n'êtes pas de confession musulmane, il est très mal vu (voire interdit) de boire et manger en public pendant la journée.

D'ailleurs, même dans les grands hôtels, il n'est pas autorisé de manger ou boire au niveau des plages et des piscines, mais uniquement dans certaines zones avec des paravents réservés aux touristes non musulmans. A noter que les hôtels utilisent parfois ce mois pour effectuer des réparations mineures ou des travaux d'entretien ce qui peut causer des désagréments pour les clients. Les femmes devront d'ailleurs se couvrir encore plus qu'en temps normal (et couvrir leurs bras et leurs jambes entièrement).

A Oman, et comme dans la plupart des pays musulmans, le vendredi est le jour de repos (l'équivalent de notre dimanche). La plupart des musées sont fermés le vendredi matin, c'est également le cas des mosquées comme la Grand Mosquée de Mascate. Les forts sont habituellement fermés lors de la prière le vendredi également. A avoir en tête lors de votre voyage !

6/ Privilégiez un voyage entre octobre et mars

Les meilleurs mois pour aller à Oman sont entre novembre et mars, mais c'est aussi la pleine saison touristique. Nous sommes allés à Oman fin mars hors vacances scolaires françaises et c'était le parfait entre-deux : il commençait à faire bien chaud mais ça restait largement supportable, avec l'avantage qu'il y avait beaucoup moins de touristes et que les prix étaient beaucoup plus abordables. De la même façon, le mois d'octobre en début de saison touristique peut constituer un bon entre-deux. Personnellement, la chaleur ne me dérange pas, mais c'est à adapter en fonction de la tolérance de chacun ! En revanche, il faut vraiment éviter les mois de mai, juin, juillet, août et septembre où il fera vraiment trop chaud !

7/ Adaptez votre journée en fonction du soleil

Comme vous l'avez compris, il fait très chaud à Oman alors privilégiez la matinée et la fin d’après-midi pour vos visites, c'est d'ailleurs à ce moment que la luminosité est la plus belle. Dans la mesure du possible, évitez de vous exposer entre midi et deux. D'ailleurs, les souks dans le pays ouvrent de 9h à 13h puis tout est très calme l’après midi, avec une reprise à partir de 16h30 jusqu'à 21h.

Pensez également à emporter crème solaire, chapeaux et lunettes de soleil. Ce n'est clairement pas le même soleil qu'en France alors n'hésitez pas à vous tartiner à toute heure pour ne pas abimer votre peau.

8/ Pensez à prendre des chaussures de rivière ou de vieilles basket pour les wadis

Pour marcher dans les wadis, pensez à amener des chaussures de rivière ou de vieilles baskets. En effet les fonds sont pleins de petits cailloux et font un mal fou.

Dans certains wadis, comme le Wadi Shab, des portions de marche et de nage se succèdent, et vous serez bien contents d'avoir emmener des chaussures de rivière et de ne pas faire le retour de la randonnée avec vos baskets toutes mouillées !

A lire : mon article sur les plus wadis d'Oman .

9/ Louez une voiture adaptée à votre itinéraire

Louer une voiture est un indispensable à Oman, sauf si vous souhaitez rester dans un hôtel et faire des excursions organisées à la journée. A Oman, vous aurez le choix entre 2 types de voitures : une berline ou un 4x4. Les 4x4 sont très fréquemment loués à Oman. Le 4X4 coûte 3 fois plus cher qu'une berline mais peut s'avérer très utile si vous avez envie de découvrir Oman hors des sentiers battus et emprunter des pistes. Il sera également indispensable si vous souhaitez aller dans les montagnes de l'Hajar (Djebel Akdhar) ou dans le désert du Wahiba Sands (mais vous pouvez tout de même demander à votre hôtel de venir vous chercher, il faut compter environ 100€ A/R). A vous d'évaluer si cela vaut le coup de louer un 4x4 en fonction de votre itinéraire. Si vous souhaitez rester sur les routes classiques, notez que les routes sont d'excellentes qualité et toute neuves, vous n'aurez donc aucun soucis en berline pour vous rendre dans les principaux wadis, village ou le long de la côte.

Pour louer votre voiture au meilleur prix je vous conseille de passer par un comparateur .

De notre côté nous avons louer un 4X4 car nous souhaitions vadrouiller un peu hors des sentiers battus notamment pour trouver des emplacements de camping sauvage, des wadis cachés, des routes de montagne... on a été très contents de l'avoir (je ne compte pas le nombre de fois où on a dit "encore heureux qu'on a un 4x4"!). Nous souhaitions également visiter le Djebel Akdhar et le Wahiba Sands, ainsi le choix a été rapidement fait même si le coût est relativement conséquent (nous avons payer 850€ pour 10 jours quand la berline était à 300€).

Attention à votre vitesse car il y a de nombreux radars sur la route !

Si mon contenu te plait, n'hésites pas à me suivre sur Instagram (@clairexplore), une jolie façon d'encourager mon travail ! <3

10/ N'attendez pas le dernier moment pour faire le plein

L'avantage à Oman c'est que l'essence est très peu chère. A environ 50 centimes le litre, ça fait plaisir ! Cependant, on s'est fait plusieurs frayeurs de panne. En effet, par moment il faut attendre plusieurs heures avant de trouver une station service, ainsi n'hésitez pas à faire le plein lorsque votre jauge est à moitié vide dans les zones les plus reculées.

Par exemple pour aller du Wadi Damm à Djebel Akhdar, aucune station service ne se trouvait sur notre route et nous n'avions plus que 150 kilomètres d'autonomie : nous avons du faire un détour de deux heures pour aller faire le plein !

11/ Pensez à dégonfler les pneus avant d'aller dans le désert du Wahiba Sands

L'avantage d'avoir louer un 4x4 est de pouvoir vous rendre vous même dans votre hébergement dans le désert au lieu de payer votre hôtel une fortune pour qu'ils viennent vous chercher (de 50€ à 100€ par personne). Cependant, il y a une chose à avoir en tête : pour pouvoir rouler sur le sable (rassurez vous le sentier est bien indiqué, il ne s'agit pas de rouler sur les dunes de sables), il faut dégonfler les pneus de votre 4×4 à 1,8 ou 2 juste avant d'entrer dans le désert. Pour ceux qui ne sont pas des pros de la mécanique, je vous conseille de vous arrêter à la station-service à l'entrée du désert, où un garagiste vous dégonflera (et vous regonflera) les pneus moyennant 1 OMR.

12/ Ne faites pas confiance aux points du GPS

De manière générale, nous avons fonctionné avec Google Maps pour nous déplacer d'un point à un autre (d'autres applications existent mais nous sommes familiers avec celle-ci). Cependant, nous nous sommes faits avoir plusieurs fois (et en parlant autour de nous, nous n'étions pas les seuls!), alors je pense que cela mérite d'en parler dans cet article. Lorsque vous inscrivez un nom de site touristique, il ne faut pas suivre l'itinéraire indiqué par Google Maps jusqu'à ce site, mais il faut inscrire le nom du parking. C'est particulièrement vrai pour les wadis. Ainsi, il nous est arrivé plusieurs fois de taper "Wadi Shab" et le GPS nous a emmené au milieu des montagnes vers le point "Wadi Shab" qui semblait pourtant correct à première vue (avec des notes et des photos), or le point indiquait le milieu de la rivière et non pas l'entrée de la randonnée, ce qui nous a valu de perdre une bonne heure sur des routes escarpées de montagne. Il faut ainsi marquer "Wadi Shab Parking" ou "Wadi Damm Pool Parking" au lieu de "Wadi Shab" ou "Wadi Damm" (les deux endroits où on s'est fait avoir).

A noter également que certains trajets proposés par Google Map sont particulièrement chaotiques et nous étions TRÈS content d'avoir un 4x4 à ces moments là : pensez-toujours à double checker le type de routes si elles s'éloignent des routes principales (surtout si vous êtes en berline). Nous nous sommes retrouvés plusieurs fois sur des routes de terres particulièrement escarpées et accidentées au milieu de nul part et il n'aurait pas fallu tomber en panne. Autant dire qu'en berline, ça aurait été mission impossible

Petit aparté également sur l’orthographe des lieux et sites touristiques, car on peut vite s'embrouiller : il faut savoir que certains endroits ont des noms avec plusieurs orthographes possibles du fait que les noms soient traduits de l'Arabe. Djebel Akhdar peut également s'écrire Jebel Akhdar ou Jabal Akhdar. Misfat se trouvera écrit aussi bien Misfat que Misfah.

13/ Laissez votre drone à la maison

Il est strictement interdit de faire voler un drone sans autorisation du gouvernement au préalable. Cette autorisation n'est délivrée que pour des vols commerciaux. Ainsi, ne l'emportez pas avec vous car il sera confisqué à l'arrivée, sans garantie de le récupérer au moment du départ. Cependant pour avoir des plans type drone sans drone, j'ai utilisé mon Insta 360 X2 et sa perche invisible . Raison pour laquelle sur mes stories Instagram d'Oman tout le monde m'a demandé comment j'avais fait pour emmener un drone ! Avec sa perche invisible, on a cette impression de hauteur comme avec un drone, ce qui donne des vidéos très réussies !

Autre alternative au drone : la dune de sable !

Si vous souhaitez plus d'informations sur cet hébergement insolite au milieu du désert j'ai écrit un article dédié à ce sujet .

14/ Demandez un visa si vous restez plus de 14 jours

Juste avant notre voyage les régulations ont changé et le visa est devenu gratuit (et automatiquement délivré à l'arrivée) pour les voyages à Oman de 14 jours ou moins : une grande chance d'avoir pris nos billets pour 12 jours sur place. Rien que pour ça, si vous hésitez entre 14 ou 15 jours, cela peut faire pencher la balance ! Un voyage de 12 ou 13 jours est pour moi le format idéal pour un voyage à Oman (sauf si vous souhaitez aller dans le Dhofar tout au sud du pays). D'ailleurs si vous souhaitez une idée d'itinéraire sur 12 jours n'hésitez pas à aller lire mon article à ce sujet .

Pour les séjours jusqu'à 30 jours, le visa coûte 20 OMR (environ 50€). Le visa de visite multientrées est quant à lui de 50 OMR. La demande doit être effectuée en ligne dans le mois qui précède le départ. A noter qu'un dépassement d’autorisation de séjour donne lieu à une amende de 10 rials par jour.

15/ Ne stressez pas quant à la sécurité du pays

Lorsque j'annonçais à mon entourage que je faisais un voyage en autonomie à Oman, à vadrouiller hors des sentiers battus en 4x4 et à dormir en camping sauvage, mes proches se sont inquiétés. En effet, pour ceux qui ne connaissent pas ce pays, Oman peut avoir une réputation insécure, où il est déconseillé de voyager ainsi. Ce n'est pas du tout le cas, et bien au contraire ! Le sultanat d’Oman est dans le top 5 des pays les plus sûrs et sécurisés du monde d’après le classement du Forum Economique Mondial. Nous ne nous sommes pas une fois sentis en insécurité et les Omanais ont été très accueillants et respectueux.

Bien sur comme partout, il faut rester vigilant et faire preuve de bon sens dans toutes situations, mais savoir qu'Oman est classé parmi les 5 pays les plus sécurisés au monde a un côté rassurant, et c'est d'ailleurs un chiffre que tu que tu pourras ressortir à ton entourage si quelqu'un te dit quelque chose à ce propos !

16/ Ne venez pas ici pour les soirées alcoolisées

Il est très difficile de trouver de l’alcool à Oman. Les seuls endroits où vous pourrez trouver de l'alcool sont dans les hôtels de luxe (et c'est absolument hors de prix). D'ailleurs à Oman, il n'y a pas de bars à l'européenne mais une multitude de "cafés" où les omanais viennent siroter jus et ice-tea (mention spéciale pour le lemon-lime juice qu'ils font dans tous les cafés, rafraîchissant et délicieux!)

Je vous parle de mes cafés Omanais préférés dans mon article Que voir, que faire à Oman ? Les 15 endroits à ne pas manquer .

A noter qu'il n'est pas non plus possible d'acheter de l'alcool dans les supermarchés car il n'y en a tout simplement pas. Des Omanais nous ont dit qu'il y a quelques magasins cachés spécialisés où ils vendent de l'alcool (interdits à toute personne musulmane) pour les expatriés. Sinon, il est aussi possible d'en acheter au Duty Free.

Quoiqu'il en soit si vous venez à Oman pour faire la tournée des bars ou passer votre temps à siroter des cocktails alcoolisés au bord de la plage, vous allez être déçus !

17/ Evitez de boire l'eau du robinet

La qualité de l'eau et l'hygiène des aliments sont satisfaisantes. A Oman, l'eau du robinet est potable en ville et dans les endroits généralement fréquentés par les touristes, mais je vous conseille cependant d'opter pour de l'eau en bouteille ou de l'eau du robinet filtrée. Cependant, en cas de nécessité, sachez qu'il est possible de la boire et que globalement il ne faut pas se méfier des aliments lavés à l'eau comme dans certains pays du Moyen-Orient. Je te conseille de prendre une gourde filtrante, comme celle de Humagreen . Je les ai contacté car beaucoup de voyageurs ne jurent que par cette marque, et ils ont accepté de m'en envoyer une pour que je teste : depuis je n'utilise plus que ça en voyage ! Elle filtre toutes les bactéries et purifie l'eau pour un goût agréable. Son petit plus c'est qu'elle peut se rouler lorsqu'il n'y a plus d'eau dedans ce qui permet de gagner de la place ! Je leur ai demandé un code code promo (CLAIREXPLORE15) pour avoir 15% de réduction sur l'achat de votre gourde si ça vous intéresse !

18/ N'hésitez pas à amener votre tente pour dormir en camping sauvage

Le Sultanat d'Oman est un des rares pays où le camping sauvage est autorisé quasiment partout (à l'exception des villes et sur les propriétés privées). C'est le paradis des baroudeurs amateurs de camping sauvage ! Pouvoir poser sa tente au plus proche de la nature, sur les plus belles plages ou dans les montagnes et se réveiller face à des paysages magnifiques est un vrai luxe. Il y a une multitude de spots géniaux et tranquilles, à l'abri des regards indiscrets. Cela permet également d'économiser le prix d'une chambre d'hôtel et de rendre le voyage moins onéreux. Nous avons eu globalement un rythme d'une nuit en camping sauvage sur deux, on a privilégié les environnement naturels en tente (les montagnes de Djebel Akhdar et Djebel Shams, les îles Daymaniat, les plages de la côte...) et les villes & le désert (Mascate, Nizwa, Wahiba Sands...) dans des hôtels.

Nous avons pris une valise en soute pour pouvoir mettre tente, duvets, oreillers et matelas gonflable. Je conseille un 4x4 pour ceux qui veulent trouver des endroits pour dormir un peu à l'écart, c'est d'ailleurs une des raisons qui nous a poussé à opter pour le 4x4. Aussi, nous avions regardé pour louer un 4x4 avec une tente pour le toit mais c'était trop cher pour nous (environ 150€ par jour de location).

Les spots que l'on a préféré pour faire du camping sont :

• au bord du grand canyon sur les hauteurs de Djebel Shams
• sur le sable blanc des iles Daymaniat et leurs eaux turquoises
• dans les montagnes de Djebel Akhdar, sous un ciel étoilé magique
• à l'entrée du Wadi Damm, sur le sable, où nous avons pu faire un feu de camp
• sur la plage de Tiwi Beach, avec les chevaux sur la plage au lever du soleil

La localisation de ces emplacements sont à retrouver dans mon autre article .

Les bouteilles de gaz vendues à Oman ne sont pas adaptées aux réchauds européens, nous avons du acheter un réchaud sur place (environ 15€) dans un supermarché car nous ne trouvions pas de bouteilles de gaz adaptées à notre réchaud. Il est interdit d'emporter des bouteilles de gaz dans la soute de l'avion.

19/ Pensez à retirer de l'argent liquide

Globalement, la carte bleue est acceptée quasiment n'importe où, même pour des petites sommes (c'est encore plus accepté qu'en Europe). Nous n'avons quasiment jamais payé en liquide, que ce soit dans les petits restaurants locaux ou dans les petits supermarchés de rue. Les seules situations où nous avons payé en cash furent dans les souks ou au marché, ainsi que dans certains hôtels reculés (comme le Wadi Al Arbeein Resort).

D'une manière générale, il est préférable d'avoir un peu d'argent liquide au cas où. Il est rare de trouver des distributeurs dans certains endroits (comme dans les montagnes) alors n'hésitez pas à retirer un peu d'argent pour votre voyage lors de votre arrivée à Mascate.

• Réserve tes activités à Oman en avance pour bénéficier du meilleur prix.
• Utilise un comparateur pour réserver tes vols comme celui-ci !

20/ Planifiez avec soin votre itinéraire

Pour éviter les détours inutiles, les pertes de temps, et économiser de l'argent, je vous conseille de planifier en avance votre itinéraire et de réserver vos hôtels en avance. L'offre hôtelière est assez chère et plus vous réserverez en avance, plus ce sera économique pour vous. Si vous souhaitez une idée d'itinéraire, je vous invite à aller consulter mon article à ce sujet : hébergements, points d'intérêts, restaurants, excursions... Tout y est !

Si vous souhaitez vous faire un hôtel d'exception à Oman, voilà la liste de mes endroits préférés (que j'ai eu l'occasion de visiter) :

• Shangri-La Barr Al Jissah Muscat (Mascate)
• Alila Jabal Akhdar (Djebel Akhdar)
• Anantara Al Jabal Al Akhdar Resort (Djebel Akhdar)
• The Chedi Muscat (Mascate)

Pour des hôtels plus accessibles, je vous conseille ces hôtels incroyables qui ont été des gros coups de coeur :

• Sama Al Wasil Camp (Wahiba Sands) sur lequel j'ai d'ailleurs écrit un article dédié .
• Wadi Al Arbeieen Resort (Al Arbeieen)
• Antique Inn (Nizwa)

BUY ME A COFFEE ♡

Si cet article t’a aidé à planifier ton voyage et que tu souhaites me remercier et me donner un petit coup de pouce alors tu peux m’offrir un petit caf’ ! C'est une belle manière de soutenir tout le contenu gratuit que je propose. Mille mercis !

J'espère que tous ces conseils auront été utiles ! Si tu as des questions quant à la préparation de ton voyage à Oman, n'hésites pas à m'envoyer un message sur mon compte Instagram . N'hésites pas à me suivre également si mon contenu t'intéresse !

Mes autres articles sur ce pays :

• Que voir et que faire au Sultanat d'Oman ? Les plus beaux endroits d'Oman .
• Itinéraire road-trip de 2 semaines
• Les plus beaux wadis d'Oman .
• Hébergement insolite dans le désert d'Oman

Partager sur

Itinéraires de voyage

Les plus beaux wadis d'oman.

Les wadis sont des lits de rivières nichés au coeur des montagnes avec des bassins naturels dans lesquels on peut se baigner dans une eau à 27 degrés. Ce sont des petits coins de paradis à la végétation omniprésente qui font la beauté et la spécificité d'Oman. Je vous dévoile mes 5 wadis préférés !

Road-trip à Oman : itinéraire de 12 jours à la découverte du Sultanat d'Oman

Un itinéraire de 12 jours à la découverte d'Oman : entre wadis, plages de sable blanc, randonnées dans les montagnes, snorkeling avec les tortues, nuit dans le désert, mosquées somptueuses, villages pittoresques, marchés typiques... nous avons pu découvrir les plus beaux endroits du Sultanat d'Oman.

Que voir, que faire à Oman ? Les 15 endroits à ne pas manquer

Que visiter lors d'un voyage dans le Sultanat d'Oman ? Je vous parle des 15 endroits que j'ai préféré lors de mon voyage à Oman : les incontournables à ne pas manquer mais aussi les pépites hors des sentiers battus.

Abonne-toi !

En poursuivant votre navigation, vous acceptez l'utilisation de cookies pour vous offrir une meilleure expérience utilisateur.

Made with ♡️ by C.L.

Clairexplore © 2018 - 2024

• Aller au menu
• Aller au menu mobile
• Aller au contenu
• Emplois et concours Emplois et concours
• Salle de presse Salle de presse
• Archives et traités Archives et traités

• Augmenter la taille de la police
• Réduire la taille de la police
• Ajouter notre fil RSS
• Partager sur Twitter
• Partager sur Facebook
• Partager sur Linkedin

Aidez-nous à améliorer encore notre service en répondant à notre enquête. Accéder au questionnaire

Merci d'avoir répondu à notre enquête.

Dernière mise à jour le : 17 avril 2024 - Information toujours valide le : 30 avril 2024

Dernière Minute

Sécurité, entrée / séjour, santé, infos utiles, voyages d’affaires.

Date de publication : 17 avril 2024

Urgence Attentat – Vigilance renforcée pour les ressortissants français à l’étranger

(Publié le 26/03/2024)

Compte tenu du relèvement, sur l’ensemble du territoire national, de la posture du plan Vigipirate au niveau Urgence attentat, une vigilance renforcée est recommandée à l’ensemble de nos ressortissants résidant ou de passage à l’étranger.

Risques encourus et recommandations associées

Risque terroriste.

Le risque d’infiltrations au Dhofar de groupes armés à partir du Yémen doit être pris en compte, même si les autorités omanaises sont très vigilantes sur le contrôle aux frontières. Les Occidentaux, y compris les Français, doivent toutefois être particulièrement prudents car ils sont une cible désignée des groupes terroristes.

Risque lié au transport maritime - Navigation

La navigation de plaisance dans l’océan Indien en général demeure dangereuse, notamment à cause d’actes ponctuels de piraterie. Il est impératif de signaler tout projet de déplacement dans la région et de se soumettre au contrôle maritime volontaire en transmettant sa position et ses intentions aussi souvent que possible à :

• État-major ALINDIEN COMFOR EAU  : par téléphone (+971 26 57 41 22 - +971 26 57 41 02 - +971 56 79 30 34) ou par courriel ( alindien-comforeau chez imfeau.ae  : inscrire en objet « pour cellule contrôle naval ») ;
• Ambassade de France auprès du sultanat d’Oman  : par téléphone : +968 24 681 809 ou +968 24 681 810.

Il est fortement recommandé aux voyageurs empruntant des embarcations de vérifier au préalable qu’elles remplissent les conditions de sécurité requises par les autorités omanaises et d’exiger la mise à disposition de gilets de sauvetage pour tous les passagers.

Manifestations

Depuis 2013, le pays n’a connu que quelques manifestations, le plus souvent de faible ampleur, qui se sont déroulées dans certaines villes du pays. Il convient de se tenir à l’écart de tout rassemblement, de rester vigilant et de s’informer.

Situation régionale

La montée des tensions régionales peut avoir des répercussions sur la situation à Oman. L’évolution de la situation dans la région doit faire l’objet d’une attention constante et soutenue.

Risques naturels

Le pays est parfois exposé à des tempêtes tropicales (rares) qui entraînent des vents violents ainsi que des pluies fortes et soudaines qui peuvent provoquer la crue brusque des wadis. Le phénomène étant dangereux pour les campeurs et les promeneurs, il convient donc d’être attentif aux conditions météorologiques.

Zones de vigilance

Les Français, résidents comme de passage, sont invités à consulter régulièrement les messages de sécurité mis à jour sur le site Internet de l’ambassade de France à Mascate .

Il est déconseillé de se rendre dans la zone frontalière du Yémen, sauf raison impérative. Les voyageurs qui pour cette raison souhaiteraient se rendre dans les zones frontalières de l’Oman avec le Yémen doivent prendre préalablement contact avec l’ambassade de France à Mascate .

Les Français qui se rendent dans le gouvernorat du Dhofar en dehors de la frange côtière doivent s’assurer que les mesures adéquates ont été prises concernant leur sécurité personnelle et maintenir en toutes circonstances un niveau de vigilance renforcée. Il convient de se tenir informé de l’actualité générale et locale avant tout déplacement dans le Dhofar. Il est conseillé de laisser à ses proches des indications précises sur l’itinéraire, la destination et le calendrier de déplacement. Les détenteurs d’un passeport diplomatique ou de service doivent informer préalablement le ministère omanais des Affaires étrangères lorsqu’ils se rendent dans certaines zones du territoire (régions du Dhofar et de Mussamdam et île de Masirah).

Recommandations générales

• Informer les services consulaires de sa présence à Oman.
• Signaler tout incident de sécurité.
• Ne pas déroger aux mesures de sécurité élémentaires, en particulier dans certains faubourgs de la capitale et en camping.
• Respecter les us et coutumes locales et adopter en toutes circonstances un comportement discret (voir rubrique Infos utiles ).

La géographie du pays, composée de zones arides, et le très faible peuplement constituent des facteurs de risque. De larges zones du pays n’étant pas couvertes par le téléphone portable, il est conseillé de signaler à un tiers son itinéraire avant toute excursion et de voyager en groupe à plusieurs véhicules en étant muni du nécessaire (eau, nourriture, pharmacie) . Il est déconseillé de pratiquer le camping seul.

Activités sportives à risque

Les excursions dans les régions désertiques (Wahibas, Rub al Khali, etc.) sont potentiellement dangereuses, si un certain nombre de précautions élémentaires ne sont pas prises. Il est recommandé de voyager en convoi (minimum 2 véhicules), avec des personnes ayant l’expérience du désert et si possible connaissant l’itinéraire, de disposer de moyens adéquats d’orientation, de signalement, de communication et de survie (notamment cartes, VHF, téléphone satellitaire ou GSM, chargeur, balise, boussole, GPS, eau, nourriture, carburant, outils et pièces de rechange pour le véhicule, matériel de désensablage, torche électrique, pharmacie).

Formalités d’entrée

Les ressortissants français doivent disposer d’un visa pour entrer sur le territoire omanais. Celui-ci est obtenu gratuitement à l’arrivée uniquement pour les séjours inférieurs à 14 jours.

Les autorités omanaises exigent que la validité du passeport excède de 6 mois la date de sortie du territoire.

Un dépassement d’autorisation de séjour donne lieu à une amende de 10 rials par jour.

Les détenteurs de passeports diplomatiques et de service sont dispensés de visa.

Demande de visa :

Depuis le 21 mars 2018, le service consulaire de l’ambassade du sultanat d’Oman à Paris ne délivre plus de visas.

Les visas de tourisme (entrée unique valable 30 jours) et les visas de visite (multiples entrées valable 1 an pour des séjours n’excédant pas 1 mois) peuvent s’obtenir, pour les Français et les ressortissants des autres pays de l’Union européenne :

En ligne :

Le document eVisa est valable 1 mois à compter de sa date de délivrance ; la demande d’eVisa est à réaliser dans le mois qui précède le départ.

• Se rendre sur le site https://evisa.rop.gov.om . Pour télécharger le Manuel d’aide procédure E-Visa (PDF - 1,36 Mo) ;
• S’enregistrer en cliquant sur «  Register as user  » ;
• S’identifier sur le site avec votre identifiant (courriel) et votre mot de passe ;
• Remplir la demande de visa en ligne ;
• Payer les frais de visa : 20 rials pour les séjours jusqu’à 30 jours, 50 rials pour le visa de visite multientrées.

Pour toute question sur le fonctionnement de ce site internet, il convient de contacter l’assistance eVisa à : Info-OmaneVisa chez rop.gov.om ou au +968 93291511 / +968 9953 7194 / +968 24512975 (numéro omanais).

Pour plus d’informations sur les types de visas proposés en fonction de votre situation, un simulateur de visa est disponible.

À l’arrivée à l’aéroport de Mascate :

Le coût du visa touristique entrée unique est gratuit pour les séjours inférieurs à 14 jours, de 20 rials pour les séjours jusqu’à 30 jours.

Pour plus d’informations sur un séjour en Oman, consulter le site de l’ office du tourisme d’Oman à Paris .

Mesures relatives à la Covid-19

Les autorités omanaises ont annoncé le 22 mai 2022 la levée de toutes les restrictions et formalités en lien avec l’épidémie de COVID-19 à l’entrée sur le territoire omanais.

Les autorités omanaises ont toutefois appelé la population à continuer à faire preuve de vigilance en matière d’hygiène et de protection contre les infections.

Les mesures adoptées par les autorités locales sont évolutives et le plus souvent d’application immédiate. En fonction de l’évolution de la situation sanitaire en Oman et dans des pays tiers, les autorités omanaises sont susceptibles de modifier, avec un très court préavis, les mesures prises.

Il est conseillé de consulter régulièrement le site Internet et les réseaux sociaux de l’ ambassade de France à Oman .

Un séjour à l’étranger implique pour tout voyageur de prendre certaines précautions en matière de santé. La rubrique ci-dessous mentionne les indications essentielles. Elles ne dispensent toutefois pas le voyageur d’une consultation chez son médecin traitant et/ou dans un centre hospitalier, suffisamment longtemps avant la date de départ pour permettre le rappel des vaccins.

Avant le départ

Frais d’hospitalisation et dépenses de santé.

Afin de faire face aux frais d’hospitalisation et aux dépenses de santé parfois très élevés à l’étranger, il est impératif de disposer d’un contrat d’assistance ou d’une assurance permettant de couvrir tous les frais médicaux (chirurgie, hospitalisation, etc.) et de rapatriement sanitaire, au risque de ne pas avoir accès aux soins, y compris en cas d’urgence vitale . Ces frais ne pourront en aucun cas être pris en charge par l’ambassade de France sur place.

Le réseau de santé publique se développe progressivement. Il existe désormais un hôpital public par sous-préfecture (wilaya). De nombreuses pharmacies et cliniques privées de quartier répondent aux besoins de santé quotidiens. Le niveau hospitalier est plus développé à Mascate.

Recommandations pour la santé

Consulter si besoin son médecin traitant ou un centre de vaccinations internationales pour faire une évaluation de son état de santé et bénéficier de recommandations sanitaires, notamment sur les vaccinations. Consulter éventuellement son dentiste avant le départ.

Les personnes qui voyagent avec des médicaments doivent être informées que certains d’entre eux ne sont pas admis sur le territoire omanais et peuvent faire l’objet de demandes d’explication de la part des forces de l’ordre. Il convient de voyager avec une copie de l’ordonnance médicale éventuellement traduite en anglais. Il est par ailleurs recommandé de se renseigner en amont du voyage auprès du ministère omanais de la Santé.

Constituer sa pharmacie personnelle en conséquence et n’emporter que les médicaments nécessaires ; ne jamais consommer des médicaments achetés dans la rue (risque de contrefaçons). Pour plus d’informations, consulter la fiche Informations pratiques .

Vaccinations

• Aucune vaccination n’est obligatoire mais certaines vaccinations sont recommandées.
• La mise à jour de la vaccination diphtérie-tétanos-poliomyélite (DTP) est recommandée, ainsi que la vaccination rubéole-oreillons-rougeole (ROR) chez l’enfant et les adultes ; la vaccination antituberculeuse est également souhaitable.
• En fonction des conditions locales de voyage, les vaccinations contre la fièvre typhoïde et les hépatites virales A et B peuvent être recommandées.
• La vaccination contre la rage peut également être proposée dans certains cas, en fonction des conditions et lieux de séjour. Demander conseil à son médecin ou à un centre de vaccinations internationales.

Risques sanitaires

Maladies transmises par les moustiques.

Le pays connaît des cas sporadiques de transmission de paludisme. Le paludisme est une maladie parasitaire transmise par les piqûres de moustiques. Les mesures classiques de protection contre les moustiques sont fortement recommandées (cf. ci-après). Pendant votre séjour, et dans les deux mois qui suivent votre retour, en cas de fièvre, un avis médical doit être pris rapidement.

Mesures générales de prévention pour se protéger des moustiques

• Porter des vêtements couvrants, amples, légers, de couleur claire ;
• Utiliser des produits répulsifs cutanés : voir à ce sujet les recommandations du ministère des Solidarités et de la Santé (PDF - 78.3 ko) et de l’ Institut Pasteur (PDF - 1.21 Mo).
• Protéger son logement (moustiquaires, diffuseurs électriques, serpentins, climatisation, etc.) ;
• Détruire les sites potentiels de reproduction des moustiques (récipients d’eau stagnante comme les soucoupes sous les pots de fleurs, les gouttières, les pneus, etc.).

Autres maladies

Coronavirus mers-cov.

Les coronavirus sont une vaste famille de virus susceptibles de provoquer un large éventail de maladies chez l’humain, qui vont du rhume banal jusqu’à une atteinte respiratoire sévère. La présentation la plus fréquente associe de la fièvre et une infection pulmonaire.

Concernant le Mers CoV, il n’existe pas de vaccin ; Les mesures classiques d’hygiène sont recommandées pour limiter les risques de transmission, en particulier le lavage régulier des mains à l’eau et au savon ou avec une solution hydro-alcoolique. Il convient également, dans la mesure du possible, d’éviter les contacts avec les animaux, les foules et grands rassemblements, ainsi qu’un contact rapproché avec des personnes malades. Éviter tout contact avec les animaux, en particulier avec les chameaux et les dromadaires. Il est très fortement déconseillé de consommer de la viande de chameau ou du lait de chamelle.

Sur place, en cas de forte fièvre, de toux et/ou de difficultés respiratoires, consulter un médecin sans délai. En cas de fièvre ou de symptômes respiratoires dans les jours qui suivent le retour en France, appeler le Centre 15 (téléphone : 15) en signalant son voyage.

Pour toute information complémentaire, consulter la page Coronavirus MERS-CoV ainsi que les sites internet du ministère français en charge de la santé et de l’ Organisation mondiale de la Santé .

Fièvre typhoïde

La fièvre typhoïde est une maladie bactérienne liée aux salmonelles. Les symptômes associent notamment une forte fièvre et des troubles digestifs et imposent une consultation médicale urgente car des complications graves sont possibles. Les précautions d’usage sont recommandées (cf. hygiène alimentaire).

Infection par le virus VIH – IST

Concernant les infections sexuellement transmissibles, il est recommandé de prendre toutes les précautions d’usage en la matière et d’éviter les comportements à risque.

Quelques règles simples

• La présence d’espèces venimeuses dans les wadis (rivières), en montagne et dans le désert (serpents, scorpions) de même qu’en mer (serpents, raies, méduses) cause régulièrement des accidents. Il est donc impératif de prendre des mesures de précaution élémentaires (chaussures montantes pour les promenades, chaussures en plastique pour la baignade).
• Secouer les habits, draps et sac de couchage pour éviter les piqûres de scorpions ou serpents.
• Éviter de marcher pieds nus sur le sable et les sols humides.
• Lors des baignades en mer, faire attention aux raies qui se dissimulent dans les sables et dont la piqûre est très douloureuse. Il est recommandé de faire attention aux serpents marins venimeux qui peuvent se trouver à proximité des zones de baignade.
• Se tenir à distance des cadavres d’animaux, des animaux et de leurs déjections.
• Ne pas approcher les animaux errants et les chiens (risque de morsure et de rage) ; ne pas caresser les animaux rencontrés.
• Veiller à sa sécurité routière (port de la ceinture de sécurité, port du casque à deux-roues).
• Ne jamais consommer de médicaments achetés dans la rue.

Pour se préserver des contaminations digestives ou de contact

• se laver les mains régulièrement avec des solutions de lavage hydro-alcooliques, surtout avant et après les repas ou le passage aux toilettes ;
• veiller à la qualité des aliments et surtout à leur bonne cuisson ;
• ne boire que de l’eau ou des boissons encapsulées ou de l’eau rendue potable (filtration, ébullition ou à défaut produit désinfectant).
• Institut Pasteur
• Santé publique France
• Organisation mondiale de la Santé

Infrastructure routière

Le respect du code de la route est impératif. Les autorités omanaises ont renforcé les contrôles autoroutiers ainsi que les sanctions applicables aux infractions du code de la route. Ne pas respecter l’arrêt à un feu rouge, dépasser sur la droite en empruntant la bande d’arrêt d’urgence, conduire sous l’emprise de l’alcool ou sans permis de conduire en cours de validité entraînent un placement en garde à vue de 48h, le paiement d’une amende et d’éventuelles poursuites judiciaires. En cas d’accidents causés en raison de ces infractions, les peines sont plus sévères.

Un réseau de routes et de pistes dessert toutes les agglomérations du pays. Les stations-service sont espacées à intervalles réguliers et sont normalement ravitaillées. Elles disposent de téléphones et d’équipements permettant des réparations sommaires.

Il convient de vérifier le contrat d’assurance des véhicules de location. Le contrat « tous risques » devra être préféré, compte tenu du coût des réparations lorsque, en cas d’accident, la responsabilité du conducteur est retenue. Par ailleurs, toute personne impliquée dans un accident de la circulation (responsable ou non) et déclarée en état d’ébriété n’est pas couverte par l’assureur du véhicule pour les dégâts matériels et corporels occasionnés. Ceci peut conduire à l’interdiction de sortie du territoire, voire un placement en détention jusqu’au règlement du litige avec les autres parties.

Dans les zones rurales, le bétail (camélidés, bovins, ovins, caprins) paît en liberté et peut traverser la route inopinément, causant des accidents mortels. Il convient donc de conduire avec prudence, notamment la nuit.

En cas d’accident, il convient de ne pas déplacer le ou les véhicules accidentés jusqu’à l’arrivée de la police, qui détient et établira le constat.

Validité du permis de conduire français

Dans le cas d’une visite en Oman, le permis de conduire français en cours de validité est reconnu par les autorités omanaises et permet de conduire un véhicule de location pendant un court séjour en Oman. Il est recommandé d’y joindre une traduction en arabe ou en anglais afin de faciliter la relation avec les agents de police pendant les contrôles routiers si vous ne pouvez présenter de permis de conduire international (qui n’est pas exigé par les autorités omanaises, mais contient une traduction arabe utile).

Législation locale

Les boissons alcoolisées ne sont pas en vente libre. Seuls les grands hôtels et grands restaurants bénéficient d’une licence permettant à leurs clients de consommer vins, bières ou spiritueux. La consommation d’alcool sur la voie publique est interdite. L’état d’ébriété peut entraîner une arrestation et constitue un facteur aggravant en cas d’accident de la circulation.

Stupéfiants

La détention, l’usage ou le trafic de stupéfiants sont interdits. De nombreux médicaments (somnifères, antidépresseurs, etc.) sont classés comme stupéfiants en Oman s’ils ne sont pas accompagnés d’une ordonnance de prescription (traduite en arabe) datant de moins de trois mois. Il est recommandé de détenir une quantité de médicaments correspondant à la durée de séjour sur place pour éviter toute suspicion quant à un éventuel trafic. Un ressortissant étranger arrêté sous ce motif sera condamné à une amende et une lourde peine de prison avant d’être expulsé.

Us et coutumes

La constitution dispose que l’islam est la religion d’État tout en garantissant la liberté de croyance. La population omanaise est globalement très tolérante. Il est toutefois recommandé d’adopter une attitude respectueuse des usages locaux et de garder à l’esprit que les différences culturelles peuvent susciter une interprétation erronée de certains comportements.

Il convient pour les hommes et les femmes de couvrir les épaules et les genoux et d’éviter les vêtements courts ou décolletés, de respecter les lieux de culte, de ne pas consommer d’alcool en public. Pendant le mois de ramadan les voyageurs doivent être particulièrement vigilants en ce qui concerne le respect des usages et coutumes du pays. Durant cette période, il est interdit de manger, boire ou fumer en public du lever au coucher du soleil.

Il est recommandé de ne pas photographier des personnes sans avoir obtenu au préalable leur autorisation. Il est interdit de photographier des bâtiments publics ou les véhicules militaires ou de la police.

Visa d’affaires

Pour les séjours professionnels, les visas tourisme (entrée unique valable 30 jours) et les visas de visite (multiples entrées valable 1 an pour des séjours n’excédant pas 1 mois) suffisent.

Pour plus d’information concernant leur obtention : consulter la rubrique Entrée / Séjour de cette fiche.

Réseaux de communication

Deux opérateurs de téléphonie mobile , Omantel et Ooredoo, offrent des services au sultanat d’Oman. Le réseau est moderne et la connexion 3G, H+, voire 4G dans les grandes agglomérations et les principaux axes routiers, est largement disponible et de très bonne qualité.

La connexion peut se faire avec un smartphone équipé d’une carte SIM locale, vendue exclusivement dans les points de vente des deux opérateurs , notamment ceux installés à l’aéroport de Mascate. Avec un mobile français en itinérance ( roaming ), le taux de couverture est très bon (100% tout au long de la bande côtière entre Mascate et la Batinah et dans les grandes villes : Sour, Salalah, Nizwa et Boureïmi). À l’intérieur des terres, dans les zones montagneuses et dans les régions désertiques, la couverture est de moindre qualité, voire inexistante. En général, les télécommunications sont très onéreuses au sultanat d’Oman, notamment en itinérance.

Données économiques

Consulter la fiche repères économiques Oman .

Contacts utiles

Service économique.

Les services économiques auprès des ambassades sont des services extérieurs de la direction générale du Trésor . Ils ont pour missions l’analyse et la veille économique et financière, sur une base macroéconomique, l’animation des relations économiques, financières et commerciales bilatérales avec les pays de leur compétence, et le soutien public au développement international des entreprises.

Service économique de Mascate – OMAN Adresse postale : PO Box 208, PC 115, Madinat Sultan Qaboos, Oman Adresse physique : Ambassade de France, Diplomatic Area, Shatti Al Qurum Tél. : +968 24 681 890 Télécopie : +968 24 681 874 Courriel : mascate chez dgtresor.gouv.fr Site Internet

Business France

Opérateur public national au service de l’internationalisation de l’économie française, Business France valorise et promeut l’attractivité de l’offre de la France, de ses entreprises et de ses territoires.

Oman relève du bureau de Riyad : Business France - Arabie saoudite Ambassade de France en Arabie saoudite Diplomatic Quarter - PO Box 94009 - Riyadh 11693 Arabie saoudite Tél. : +966 1 488 08 80 Courriel : riyad chez businessfrance.fr Directeur pays : Pascal Roger

Les Conseillers du commerce extérieur de la France (CCEF) forment un réseau actif de plus de 4 000 membres dans 146 pays , au service de la présence française dans le monde. Ils mettent leur expérience pour conseiller les pouvoirs publics, parrainer les entreprises, former les jeunes aux métiers de l’international et promouvoir l’attractivité de la France pour les investissements internationaux.

Site internet : Comité national des conseillers du commerce extérieur de la France

Spécialiste des marchés alimentaires, Sopexa est une entreprise internationale de marketing et de communication dont une agence est située au Moyen-Orient. Site Internet

Oman et le FMI

Bienvenue à Oman

Trouvez votre prochaine expérience, thémes populaires, parmi les voyageurs, plages & littoraux, avantages de notre agence.

Agence locale experte de la destination pour des voyages au tarif le plus juste

Paiement par carte bancaire sans frais auprès du collectif Nomadays, agence française

Réservation encadrée par la législation française. Remboursement intégral ou report sans frais en cas de fermeture des frontières

Agence plébiscitée par la communauté des voyageurs, et reconnue pour son professionnalisme

Inspirations

Laissez-vous inspirer par nos idées de circuit, et construisons ensemble un voyage à votre mesure.

Exploration du Dhofar

Oman du nord au sud.

Tous nos voyages peuvent être privatisés et personnalisés selon vos envies. N'hésitez plus, contactez-nous !

Splendeurs omanaises

Splendeurs omanaises avec extension mussandam, vos vacances au sultanat d'oman.

Mer , wadis , montagnes et déserts : une incroyable variété de paysages qui raviront les Amoureux de la Nature dans une boucle de 200 km autour de Mascate !

La sérénité des lieux invite également aux activités de bien-être : découvrez le Zema Tawi Yoga , une pratique énergique plurimillénaire, à pratiquer de préférence en nature, au désert, à la montagne et au bord de l'eau, ou au sein des plus beaux hébergements zen nichés dans des lieux naturels chargés d'énergie. C'est aussi l'opportunité de vivre le moment présent et d'accéder à la pleine conscience.

Un peuple chaleureux , généreux, hospitaliers et gardiens de traditions ancestrales que vous découvrirez au fil de vos rencontres avec la population locale.

Oman est une destination propice pour les activités de plein-air et notamment le trekking , la randonnée, le kayak de mer, le snorkeling, la plongée, le canyoning, l'escalade, la via-ferrata, la zipline, la montgolfière et encore plein d'autres surprises.

Khasab et ses Fjords d'Arabie au Musandam sont seulement à 1 heure de vol de Mascate et 2 heures de route de Dubaï.

Salalah , la Caraïbe d'Arabie du Dhofar au sud d'Oman, est à seulement 1h30 de vol au départ de Mascate et de Dubaï. Cette région, propice au tourisme balnéaire, vous surprendra avec ses longues plages de sable blanc bordées de cocotiers. C'est aussi le point de départ pour un Trek Désert au cœur du célèbre Rub Al Khali.

Nouvelles de Oman

Que faire à oman : top 5 de nos activités favorites, visite de mascate, capitale et porte d'entrée du sultanat d'oman, abonnez-vous à nos lettres d'information.

Voyage Oman est une agence de voyage omanaise basée à Mascate depuis 2014. Entre découverte du pays sous toutes ses facettes (paysages, culture, mode de vie, activités..), confort et authenticité, nous mettons tout en œuvre pour parfaire votre voyage au cœur de notre terre d’accueil. Sécurité, accompagnement de qualité et confort sont nos préoccupations principales.

Voyage Oman est membre du collectif d'agences locales Nomadays . Construisez votre voyage sur mesure en direct avec une agence locale spécialiste de sa destination.

• Destinations
• Où partir ?
• Nos engagements
• Centre d'aide
• Amérique centrale
• Amérique du Nord
• Amérique du Sud
• Moyen-Orient

• Où partir ?
• Voyage en famille
• Voyage de noces
• Voyage en couple
• Voyage en petit groupe
• Roadtrip et autotour
• Voyage Safari
• Voyage aurore boréale
• Voyage au soleil
• Circuits 2 semaines
• Circuits 10 jours
• Circuits 1 semaine
• Où partir au printemps
• Où partir en été
• Où partir en mars
• Où partir en avril
• Où partir en mai
• Où partir en juin
• Où partir en juillet
• Où partir en août
• Voyage randonnée et trek
• Voyage en train en Europe
• Voyage à vélo
• Voyage nature
• Voyage culinaire
• Avec qui partir ?
• Que faire ?
• Quand partir ?
• Comment voyager autrement ?
• Voyage à Oman
• Circuits Oman

Circuits à Oman : Des idées 100% personnalisables

• Exploration

Voyager à Oman selon vos envies

Partir à Oman: derniers conseils !

Bienvenue dans cette petite parcelle d’Arabie qui transformera votre regard sur le Moyen-Orient… L’histoire du Sultanat d’Oman est riche de 5.000 ans d’histoire. Plus de 500 forts (de style perse, portugais ou arabe) ponctuent le territoire, et les influences venues d’Inde et d’Afrique se manifestent dans la gastronomie, l’architecture ou même les vêtements… Le Sultanat d’Oman a longtemps été une plaque tournante du commerce entre l’Occident et l’Orient, à la croisée des routes maritimes entre l’Asie, l’Afrique de l’Est et l’Europe. L’héritage de cette situation stratégique, visible aujourd’hui encore. Une tradition d’ouverture et d’hospitalité qui conduit Oman à très bien accueillir les voyageurs. L’histoire unique et le caractère de cette terre métissée à l’envoûtant parfum d’encens ne vous laisseront pas indifférents ! Côté villes, vous ferez nécessairement halte à Mascate, la capitale : on y aime ses souks, ses châteaux et la grande Mosquée du sultan Qabous. Ici, bien moins de hauts buildings ou de gratte-ciels que dans les Emirats voisins, la capitale omanaise s’apparente plutôt à un grand village de pêcheurs. On y découvre aussi des forts portugais, les seuls Occidentaux à avoir colonisé le pays. On aime aussi Nizwa, au carrefour des pistes des caravaniers du nord et du sud, avec son fort et ses enchères au bétail, Sur et son ancien port ou Salalah, réputée pour ses souks et où l’on pratique le commerce de l’encens.

Un circuit dans le Sultanat d’Oman c’est la chance de flirter avec trois univers naturels exceptionnels : déserts, mers et montagnes qui offrent au visiteur un voyage riche et varié. Avec ses hautes dunes et ses pierres, le désert recouvre 80% de la surface du pays. A portée de main de la capitale (moins de deux heures de route), le désert de Wahiba est par exemple la possibilité de découvrir l’immensité de cet univers. Campement en grand confort de campements ou bivouac à la belle étoile, un voyage qui vous marquera pour longtemps vous y attend… Notez d’ailleurs que le camping en pleine nature est autorisé partout dans le pays ! Changeons d’horizon : avec plus de trois mille kilomètres de côtes, Oman est parfois surnommé le « Sultanat de la Mer ». Fjords, villages traditionnels ou falaises qui tombent à pic dans la mer, les rivages omanais sont autant sublimes que variés… Dernier élément qui marquera votre itinéraire à Oman : les montagnes ! Verdoyantes, minérales ou arides, les montagnes ont plus d’un visage et sont le terrain idéal pour de nombreuses activités… Ces montagnes abritent des grottes de taille gigantesque. A noter qu’on trouve à Oman la plus vaste du monde grotte du monde : Majlis Al Jinn, qui pourrait contenir jusqu’à huit avions Boeing ! Dans le Sultanat d’Oman, la surprise sera nécessairement au rendez-vous !

Votre navigateur est obsolète !

Mettez à jour votre navigateur pour afficher correctement ce site Web.

Mettre à jour maintenant

• Afrique du Sud
• Île Maurice
• Ile Rodrigues

• Corée du Sud
• Kirghizistan
• Ouzbékistan
• Philippines

Moyen orient

• Emirats Arabes Unis

• Nouvelle Zélande

Découvrez nos idées de voyage...

Vous préférez voyager :

• Hors des sentiers battus
• Luxe & charme
• Rencontre et vie locale
• Trek et randonnées
• Voyage de noces
• Partir en Week-end

Quelle durée :

• Partir moins de une semaine
• Partir de 1 à 2 semaines
• Partir + de 2 semaines

Quand partir :

• En septembre
• En novembre
• En décembre

Voir toutes nos idées de voyages

Voyage sur mesure à oman.

Idées de voyage à Oman

Voyage sur mesure à oman avec une agence locale, découvrez les circuits de nos agences locales.

• A partir de 1268 €

• A partir de 1768 €

• A partir de 2048 €

• A partir de 1436 €

• A partir de 1586 €

• A partir de 1526 €

• A partir de 890 €

Que voir à Oman : les incontournables

Cette capitale atypique toute blanche offre de nombreuses visites. Voir le quartier de Muttrah, le Palais Royal, la Corniche, le Souk, la Grande Mosquée Kaboos

Etape importante pour la vielle ville de Sur, la visite de Ras Al Jinz, lieu célèbre dans le monde entier pour la ponte des tortues vertes, bain dans le trou d’eau de Bimmah

Dans cette région, voir la ville de Nizwa, son fort, ses châteaux, ses tours, le marché aux bestiaux le plus important de la région, les montagnes environnantes du Hajar occidental

Les montagnes de la région de Jabal Shams et de Jabal Akhdar offrent de merveilleux paysages et de superbes randonnées

Ce désert avec ses dunes changeant de couleurs tout au long de la journée est un incontournable, faire un stop pour un bain dans le Wadi Bani Khali, ne pas manquer le coucher de soleil fabuleux sur le désert

Un des plus vieux village d'Oman dans une palmeraie au pied des Montagnes Hajar. Voir ses maisons de mudbrick de trois étages construites dans le style Yéménite

Visite de Khasab, ne pas rater la croisière en Dhow dans les fjords accompagnée des dauphins, les hauteurs de Khassab à Khawr Najid pour admirer et immortaliser les points de vue imprenable surplombant l’océan Indien

Un autre visage du Sultanat difficile à imaginer, cocotiers et plages, Montagnes vertes grâce à son climat particuliers. Prevoir un séjour de 2 à 3 jours sur Salalah, capitale de l'encens

Ces iles au large de Mascate offrent des sites de plongée uniques, coraux, requin baleine. Lieu de prédilection pour les plongeurs.

Bien préparer son voyage à Oman

Ce trajet peut aussi se faire dans le sens inverse avant de continuer votre séjour par la région de Musandam au Nord à la découverte des fjords ou à Salalah en prenant un vol intérieur. Vous disposez d’environ trois semaines, il est possible de faire le grand tour du Sultanat de Mascate à Salalah par la route côtière et de revenir par le centre et le désert. Notre agent local à Oman construit avec vous votre parcours pour des vacances uniques

Vous pouvez aussi atterrir et commencer votre tour à Dubaï, visiter la ville puis prendre un vol sur Mascate ou Salalah.

Que faire en Oman ?

S’imprégner des senteurs d’encens du souk à muttrah, quartier sur le port de mascate.

Mascate est une capitale est surprenante, aucun gratte-ciel, des quartiers entourés de collines aux maison blanches de l’aéroport au port de Muttrah font le charme de cette ville. Les anciens forts portugais Jilali et Mirani dessinent le relief de la vielle ville où se trouve le Palais du Sultan Qaboos Bin Said et le musée National. Préférez les heures matinales pour visiter la Grande Mosquée, l’Opéra et sa remarquable architecture. Il fait bon flâner l’après-midi à Muttrah pour s’imprégner de l’atmosphère omanaise au coucher du soleil et terminer par le souk, les senteurs d’encens vous accompagnent dans ce dédale de ruelles dans lesquelles vous dénicherez les bonnes affaires. Si vous restez plusieurs jours sur Mascate, découvrez au sud de la ville les belles plages de Yitti, de Al Bustan, de Jissah.

Faire un stop dans la ville côtière de Sur

cité bâtie à fleur d’océan entourée de collines ocres, est l’endroit où se fabrique les boutres traditionnelles. Ne manquez pas la vielle ville qui paraît figée dans le temps.

Observer le comportement des tortues à Ras al Jinz

Il faut y passer 1 nuit pour observer la ponte des tortues. Il est très intéressant de voir le rituel de ces animaux venu pondre sur cette portion de littoral. Le spectacle des bébés tortues, attendus par les prédateurs, essayant de gagner le large est toujours très émouvant.

Explorer les dunes dans le désert du Wahiba Sands en 4X4

Pour vivre une expérience inoubliable, passez 1 nuit ou plus dans un camp à l’atmosphère conviviale. Une promenade à dos de dromadaire au coucher du soleil est très appréciée des familles. Les couleurs des dunes de ce désert au lever et au coucher du soleil sont magiques.

Prendre un bain à Wadi Bani , une des plus belles oasis du pays avec ses piscines naturelles aux eaux turquoise à l’intérieur des rochers.

Assister au marché à bestiaux de Nizwa

A Nizwa , visiter la plus grande forteresse d’Arabie, joyau architectural du 17 ème qui jouit d’un très beau panorama sur l’oasis. Ce fort dont la tour principale est impressionnante par sa hauteur et sa largeur domine la ville et la mosquée. Venir tôt si vous voulez assister au très animé marché aux bestiaux et vous attarder dans le souk pour ses dattes, ses épices, son artisanat. Dans les environs de Nizwa, voir également le fort de Bahla et le château de Jabreen. Voir et s’arrêter dans les criques aux plages désertes le long de la cote de Mascate à Salalah.

Randonner dans les montagnes du Jabal Shams

Oman, ce sont aussi des sommets, des chemins de randonnées entre canyons et oasis. les amateurs de trek seront ravis de passer plusieurs jours à la découverte de village perchés, de rencontrer les villageois, de voir des paysages grandioses.

Passer 2 jours à Khasab pour explorer en boutre traditionnelle les fjords de Musandam

Khasab est situé au nord dans la péninsule de Musandam, prendre un vol au départ de Mascate est le moyen le plus rapide pour s’y rendre. Prévoir une journée pour une excursion en boutre dans les fjords à la rencontre des dauphins, est une expérience inoubliable .

Plonger sur les Iles Daymaniyats

Ces iles sont un sanctuaire protégé et classé par L’Unesco. Les amateurs de plongée ou de snorkling seront comblés par les fonds marins et la faune variée. De nombreuses espèces sont répertoriées notamment le requin baleine, une excursion sur ces iles s’organise à la journée.

Changer de décor à Salalah, surprenant cadre exotique

Le Dhofar , cette région d’Oman étant sous l’influence de la mousson entre juin et septembre est totalement différente et offre des paysages verts et tropicaux. Salalah , beaucoup moins touristique que le Nord, est le point d’entrée et la principale ville du Dhofar. Voir le souk Al Husn, la tombe de Nabi Imram, le musée de l’encens, les ruines de la cité Al Balid, la plantation de bananes, se promener sur la très belle plage au coucher du soleil.

Pour plus d’informations parcourez notre  GUIDE DE VOYAGE OMAN

Infos pratiques sur Oman

Quand partir.

Toute l’année, il vaut mieux cependant éviter les mois les plus chaud de mai à aout. La saison idéale se situe entre novembre et mars

Décalage horaire

Le décalage horaire entre la France et Oman est de + 2 heures en hiver et 3 heures en été

Formalités d’entrée

Passeport en cours de validité et visa électronique (Attention plus aucun visa n’est délivré aux aéroports ou frontières). Le visa coute environ 20 OMR( environ 45 € )

Santé & vaccins

Vaccination usuelle

Voir le guide complet sur Oman

Voir les avis de voyages en Oman

Avis de voyageurs partis à Oman

Un grand merci tout d’abord pour l’ensemble des choix tout au long de ce parcours qui nous a permis d’avoir une bonne vision du sultanat Ce que nous avons découvert is « So different » de nos habitudes que nous terminons enthousiasmés de la variété des paysages de montagnes exceptionnels du Djebel Akdar de cette expérience du désert de Wahiba des différents Wadi dont le dernier « Bani Khalid » avant de découvrir la vie des tortues sur la plage de Raz Al Jinz puis retour dans le magnifique hotel Changri-La de Mascat. Ce fut aussi un très beau et reposant dernier jour.

Merci à Jasmin pour ce superbe voyage, les paysages à Oman sont fabuleux, les hotels super, la nuit dans le désert du Wahabi Sand à ne pas manquer. Il ya peu de guides francophones mais Jasmin a su trouver la perle rare avec Hilal. Ponctualité, 4X4 très confortable pour découvrir le désert, les paysages de montagnes. Nous sommes restés en fin de circuit au Crown Plaza pour nous reposer sur les plages d'Oman. Bon niveau d'hôtel et excellent rapport qualité Je recommande

Nous avons beaucoup apprécié ce voyage à Oman. La population est très accueillante, ouverte et gentille. On se sentait plus en sécurité que dans beaucoup de villes françaises. Le réseau routier et la propreté des grandes villes est impressionnant. Grace à nos 2 guides nous avons beaucoup appris sur la culture, histoire et religion d’Oman. C’était très enrichissant. L’agence local Jasmin comme contact était top. On a apprécié la proactivité et la communication par WhatsApp très efficace.

Les autres pays que vous pourriez aimer

Partir en Namibie

Partir en Espagne

Partir en Birmanie

Partir en Mongolie

Partir en Islande

Partir à Ile Rodrigues

Partir à Hawaï

Partir en Arménie

Partir à Cuba

Une fois connecté(e), vous aurez accès à votre compte et à vos échanges avec votre agence locale…

Vous êtes nouveau sur Nirvatravel ? Inscrivez-vous

Créez votre compte

Vous êtes déjà un compte sur Nirvatravel ? Connectez-vous

Oubli de mot de passe

• Voyage Oman
• Déconnecter
• Je voyage en solo
• Les grands voyages
• L'Esprit Voyageurs
• Nature et art de vivre
• Noël & Réveillons
• Partir à deux
• Sous le soleil exactement
• Vacances de février
• Vacances de la Toussaint
• Vacances de Pâques
• Voyages avec vos enfants
• Voyages de luxe
• Voyages de noces

Contactez un conseiller spécialiste Oman 01 85 08 10 43

Idées voyages à Oman

Voyages itinérants Oman - Mascate - Wahiba Desert

Oman avec les enfants - la plage et les dunes pour terrains de jeu.

Dormir sous une tente dans le désert, voir les dauphins dans le Golfe, dévaler les dunes et se baigner dans des piscines[...]

9 jours, de 2700 à 3800 €

NOS VOYAGES ITINÉRANTS OMAN

Voyages itinérants Oman - Mascate - Wahiba Desert - Al Hamrah

Du golfe d'oman au silence du désert - le sultanat grand angle.

Cités millénaires, wadis et montagnes puissantes : les grands sites naturels et culturels du Sultanat

8 jours, de 3400 à 4500 €

Voyages itinérants Oman - Dhofar - Salalah - Mirbat - Rub al Khali desert

Route de l'encens, mer d'arabie & douceur tropicale- au sud, oman pour initiés.

Découvrir loin des foules un Oman confidentiel, entre côte sauvage, désert infini et douceur tropicale

9 jours, de 3800 à 5200 €

Voyages itinérants Sharjah - Oman - Khasab - Mascate - Wahiba Desert - [...]

Sharjah inattendu, oman historique- un autre voyage en terres arabes.

Après la capitale culturelle des Émirats, explorer le nord omanais pour une approche complète de l'histoire du sultanat

10 jours, de 5200 à 7100 €

Voyages itinérants Oman - Inde du Sud - Mascate - Sur - Désert de Wahiba - Nizwa [...]

Après oman, cap sur bombay et goa - le long de la route des épices.

Se faire surprendre par Oman, séduire par l'Inde du Sud et chiller trois jours sur la côte

14 jours, de 5300 à 7300 €

Voyages itinérants Oman - Mascate - Wahiba Desert - Djebel Al Akhdar

En tête-à-tête à oman - hôtels à part et nuits dans le désert.

En trois temps, découvrir toute la diversité des paysages omanais, de la capitale aux montagnes

8 jours, de 5900 à 8100 €

Conciergerie francophone

Appli carnet de voyage

Gagnez des miles

Absorption CO2

Un grand professionnalisme dans l'écoute pour la préparation du voyage. Une totale satisfaction dans le respect de nos attentes. Quelques belles surprises et attentions pour fêter un évènement familial au cours du voyage ! Nous reviendrons certainement vers vous pour nos prochains voyages.

Voyage exceptionnel à Oman, parfaitement anticipé et organisé par des collaborateurs pertinents, attentifs, prévenants, aussi bien en agence que sur site. 10 jours fabuleux.

Sublime et inoubliable voyage à Oman. Voyageurs du Monde a parfaitement compris nos envies de voyages, sachant que nous avons voyagé avec 3 générations (des grands-parents aux petits enfants). Des petites attentions et surprises pour les enfants, à l'itinéraire très bien réfléchi, ce voyage a été magique pour toute la famille. Gros bonus pour la présence irremplaçable de notre concierge, toujours disponible pour nous conseiller et nous donner de bonnes adresses. Lire la suite

Le guide Oman

Guide Pratique

Quand partir à Oman

Radio Voyageurs : 100% Oman

24 heures à Mascate

Oman, 5 wadis à contre-courant

Oman, le pays des légendes

5 bonnes raisons de partir

Mieux préparer votre voyage à Oman

Ce que l’on trouve lors d’un voyage à oman que l’on ne trouve pas ailleurs:, pour quels voyageurs , les meilleures formules pour découvrir oman :, vivre un moment unique lors d’un voyage à oman :, où voyager à oman .

Plus de 200 conseillers spécialisés par pays et régions, vous aident à créer un voyage selon vos envies et votre budget.

Personnalisation

Suivant les suggestions de votre conseiller mais aussi vos idées, nous construisons un voyage ultra-personnalisé : étapes, hébergements, activités, rencontres...

Conciergerie francophone à destination, assistance 24/24, salons lounge, douanes rapides, early check-in : un éventail de services d’excellence à votre disposition.

• Conseillers destinations
• Nos agences

Bonjour, Ni attente ni loupé dans nos Cités des Voyageurs. En prenant rendez-vous au jour et à l’heure qui vous conviennent, vous pourrez confortablement échanger avec l’un de nos spécialistes pays.

01 85 08 10 43

Bonjour, Nos conseillers par destination sont à votre écoute sur rendez-vous par téléphone ou par visio du lundi au samedi de 9h à 19h, ou bien en agences de 10h à 18h.

Où souhaitez-vous partir ?

• Afrique du Sud 01 84 17 57 32
• Argentine 01 84 17 19 49
• Australie 01 84 17 21 66
• Birmanie 01 85 08 10 41
• Brésil 01 84 17 21 65
• Cambodge 01 83 64 79 43
• Canada 01 84 17 57 98
• Chili 01 83 64 79 44
• Chine 01 84 17 19 21
• Costa Rica 01 83 64 79 38
• Croatie 01 83 64 79 48
• Cuba 01 83 64 79 40
• Egypte 01 84 17 19 01
• Espagne 01 83 64 79 06
• Etats-Unis 01 84 17 57 96
• Finlande 01 85 08 10 45
• Grèce 01 84 17 21 63
• Ile Maurice 01 84 17 70 91
• Inde 01 84 17 21 64
• Indonésie 01 84 17 19 12
• Islande 01 83 64 79 42
• Irlande 01 83 64 79 21
• Italie 01 84 17 46 76
• Japon 01 84 17 19 48
• Maldives 01 83 64 79 35
• Maroc 01 84 17 21 68
• Mexique 01 84 17 21 67
• Namibie 01 83 64 79 41
• Norvège 01 85 08 10 42
• Oman 01 85 08 10 43
• Pérou 01 84 17 21 60
• Polynésie 01 84 17 21 62
• Portugal 01 84 17 21 69
• Réunion 01 83 64 79 45
• Royaume Uni 01 85 08 10 40
• Russie 01 84 17 21 61
• Seychelles 01 84 17 70 92
• Sri Lanka 01 83 64 79 39
• Tanzanie 01 84 17 57 33
• Thaïlande 01 84 17 19 47
• Turquie 01 85 08 10 44
• Vietnam 01 84 17 19 46
• Autres Pays 01 42 86 16 00

Bonjour, Appelez-nous et prenez rendez-vous ! Du lundi au samedi de 10h à 18h dans nos Cités des Voyageurs. Ou encore sur rendez-vous par téléphone ou par visio du lundi au samedi de 9h à 19h. Et que le voyage commence !

• Bordeaux 05 57 14 01 48 28, rue Mably 33000 Bordeaux
• Bruxelles +32 2 543 95 50 Chaussée de Charleroi 23 1060 Bruxelles
• Genève +41 22 518 04 94 Rue de la Rôtisserie 19 1204 Genève
• Grenoble 04 76 85 95 90 16, boulevard Gambetta 38000 Grenoble
• Lausanne +41 21 519 10 65 Rue de bourg, 6 1003 Lausanne
• Lille 03 20 06 76 25 147 bld de la Liberté 59000 Lille
• Lyon 04 72 56 94 56 5, Quai Jules Courmont 69002 Lyon
• Marseille 04 96 17 89 17 25, rue Fort-Notre-Dame 13001 Marseille
• Montpellier 04 67 67 96 30 8, rue du Palais Des Guilhem 34000 Montpellier
• Montréal +1 514-722-0909 295 rue de la Commune Ouest H2Y 2E1 Montréal
• Nantes 02 40 20 64 30 13 rue du Moulin 44000 Nantes
• Nice 04 97 03 64 64 4, rue du Maréchal Joffre 06000 Nice
• Paris 01 42 86 16 00 55, rue Sainte-Anne 75002 Paris
• Québec +1 418-651-9191 540 rue Champlain G1K 4J3 Québec
• Rennes 02 99 79 16 16 31 rue de la Parcheminerie 35102 Rennes
• Rouen 02 32 10 82 50 17-19 rue de la Vicomté 76000 Rouen
• Strasbourg 03 88 15 29 48 16 rue Sainte Barbe 67000 Strasbourg
• Toulouse 05 34 31 72 72 26, rue des Marchands 31000 Toulouse