rainbow tours dubai

Dokąd chcesz jechać?

Skąd wyjazd?

Typ Transportu

Zjednoczone Emiraty Arabskie

Typ wyjazdu

Standard hotelu

Ocena klientów

Udogodnienia w hotelu

Rodzaj hotelu

Odległość hotelu od lotniska

Dubaj wakacje

Znaleziono 28 ofert

Region: Dubaj

Waluta: AED

Powierzchnia: 3885 km 2

Liczba ludności: ‍2 262 000

Dlaczego warto wyjechać na wczasy do Dubaju?

Co warto wiedzieć przed podróżą do dubaju, pogoda w dubaju, co zobaczyć w dubaju, loty do dubaju, co zjeść z dubaju, jakie pamiątki przywieźć z dubaju, najlepsze artykuły o dubaju:, wyspy palmowe w dubaju – perełka zea.

Wyspy Palmowe to projekt, który na stałe zmienił kształt linii brzegowej Dubaju. Poznaj ich historię i dowiedz się, co mają do zaoferowania.

TOP 10 - Największych atrakcji w Dubaju

Wybierasz się na wakacje w Dubaju? Sprawdź nasze top 10 atrakcji, które musisz zobaczyć. Zainspiruj się blogiem o podróżach r.pl

Podróż do Dubaju – co warto wiedzieć

Dubaj to największe miasto w całych Zjednoczonych Emiratach Arabskich. Sprawdź co warto wiedzieć przed podróżą. Zapraszamy na blog r.pl

Zakupy w Dubaju – Dubai Mall

Zakupy w największym centrum handlowym na świecie – Dubai Mall. Dowiedz się więcej o tym fascynującym obiekcie na blogu o podróżach r.pl

Egzotyczna podróż poślubna. Dwie niezwykłe propozycje!

Przed Wami najpiękniejszy czas w życiu. Jeśli - razem ze swoją drugą połową - planujecie szczegóły ślubu, nie zapominajcie, żeby sobie również podarować coś wyjątkowego. Gdzie zatem udać się w podróż poślubną? Odpowiedź jest prosta: miłość najwdzięczniej rozkwita w egzotycznych zakątkach.

Opinie o Dubaju:

Ocena ogólna Dubaj

Co mam pisać, że fajnie, że ładnie? a może inaczej? Nie to podróż życia i nie żałuję że z Rainbow, a raczej cieszę się z tego. Już szukam nowego miejsca do zobaczenia. Dziekujeębyło super!!

Futurystyczne miasto przyszłości z nawoływaniem muezina w tle. Dużo słońca, egzotyka, pyszne jedzenie i niezapomniane chwile na safari po pustyni.

Miasto z Bajki o Lampie Alladyna.Do zobaczenia za jakiś czas.

Za kilka lat bedzie to wielkie skupisko ludzi

Miasto jest super, wszystko to o czym nam się marzy można tam odnaleźć. Nawet jeśli zwiedzając mówimy sobie "nic już mnie w Dubaju nie zaskoczy" to gwarantuję, że zaskoczy i to nie raz i nie dwa. Z całą pewnością tam wrócę.

niesamowite miejsce- wszystko naj (najwyższe, najlepsze, najbogatsze), warte odkrywania na nowo, zaskakujące

Zaskakująca i maksymalnie zróżnicowana infrastruktura. Siedem najwyższych budynków świata. Bajeczne i luksusowe hotele pełne atrakcji. Zachwycające wyspy palmowe.

Miasto 1001 nocy.Bajka.Rozmach ,czystość,kultura. brak alkoholu potwierdza że nie ma w tedy zła. Ludzie bardzo przyjaźni.

fajnie odpocząć na plaży po kilkudniowym zwiedzaniu.

Niezapomniane wrażenia i widoki. Połączenie luksusu z egzotyką i magią. Tygodniowy pobyt wydaje się być zbyt krótki, żeby zobaczyć wszystko co warte uwagi i nacieszyć się wypoczynkiem na pieknej , piaszczystej plaży.

Pobierz aplikację mobilną Rainbow

i ciesz się łatwym dostępem do ofert i rezerwacji wymarzonych wakacji!

"Rainbow" Private Tours

• Bachelore Diploma:Teacher
• Turkish • Russian • English
• Professional tour guide

Similar Experiences

"Rainbow" Private Tours Guide - All You Need to Know BEFORE You Go (2024)

"Rainbow" Private Tours

• Bachelore Diploma:Teacher
• Turkish • Russian • English
• Professional tour guide

Similar Experiences

"Rainbow" Private Tours - All You Need to Know BEFORE You Go (2024) - Tripadvisor

"Rainbow" Private Tours

• Bachelore Diploma:Teacher
• Turkish • Russian • English
• Professional tour guide

Similar Experiences

"Rainbow" Private Tours (Dubai, United Arab Emirates): Address - Tripadvisor

Rainbow Private City Tours

• Private transportation
• Entry/Admission - Dubai Creek
• Lunch & Dinner; Burj Khalifa observation deck entrans fee
• Entry/Admission - Dubai Miracle Garden
• Picking up from Hotels, Airport and Cruise Ship Terminals
• Port Rashid
• Dubai International Airport
• Not wheelchair accessible
• Near public transportation
• Confirmation will be received at time of booking
• No heart problems or other serious medical conditions
• Most travellers can participate
• This experience requires good weather. If it’s cancelled due to poor weather, you’ll be offered a different date or a full refund
• This is a private tour/activity. Only your group will participate
• For a full refund, cancel at least 24 hours in advance of the start date of the experience.
• You'll get picked up See departure details
• 1 Dubai Creek Stop: 60 minutes - Admission included See details
• 2 The Dubai Fountain Stop: 3 hours See details
• 3 Palm Jumeirah Stop: 60 minutes See details
• 4 Souk Madinat Jumeirah Stop: 30 minutes See details
• 5 Burj Al Arab Stop: 20 minutes See details
• 6 Dubai Marina Stop: 30 minutes See details Pass by Mall of the Emirates
• 7 Dubai Miracle Garden Stop: 2 hours - Admission excluded See details Pass by World Trade Centre
• 8 Dubai Festival City Mall Stop: 3 hours See details
• You'll return to the starting point

More to explore in Dubai

Rainbow Private City Tours provided by "Rainbow" Private Tours

Middle East Chevron

United Arab Emirates Chevron

Dubai Chevron

15 Best Desert Safaris in Dubai

By Maresa Manara

A desert safari is one of the best ways to experience Emirati culture. From quad biking over sand dunes to camping under the stars to taking a sunrise hot air balloon tour, here's our pick of the very best desert safaris in Dubai. Ante up the adrenaline, and dive on in.

Bedouin Life, Falconry, and Wildlife Drive by Platinum Heritage Arrow

While this tour’s selling point is that it lets guests "experience life as a Bedouin nomad," being picked up at your hotel door in a luxury Land Rover sets things off on a more comfortable foot. Camels will take you to the Bedouin camp in time for sunrise, and the wildlife safari in the Desert Conservation Reserve, which stops to see local animals, is once-in-a-lifetime. Guides are great: they’ll help you prepare traditional Arabic dishes (Ful medames, Arabic bread, and desserts) and explain the ins and outs of local Arabic dancing.

Overnight Safari by Rayna Tours & Travel Arrow

Drivers take Al Awir road into the desert for some dune driving and photos at sunset. From there, head to the camp for camel rides. Next up, there’s a belly dancing show and open bar, henna painting, and a fire show. However, it’s the overnight experience that is truly special. Once all the other guests have left, guides set up camp with sleeping bags and blankets, and a special star gazing talk. Watching the sunrise from your camp over breakfast is unforgettable. If you pre-book, guides will stop for some sand skiing and quad biking opportunities on the way back to Dubai.

Evening Desert Safari by Atlanta Safari Dubai Arrow

There’s something magical about venturing into the desert at night, and this late afternoon-evening safari is no different. This is the kind of tour where guests feel completely looked after. Once everyone reaches camp, there are pre-dinner snacks, henna tattoo opportunities and live dance shows. The buffet barbecue dinner (couscous, fresh salads, lamb roasted below ground, grilled prawns, chicken and apricot stews) is one of the best we’ve had on a desert safari.

Overnight Desert Safari and Hot Air Balloon flight by Platinum Heritage Arrow

Luxury safaris don’t get much better than this, and the hotel pick up in an open-top vintage Land Rover’s your first clue. As you leave the city behind and head for the desert, guides regale guests with tales of Dubai’s history, as well as a run-through of local customs and traditions. Once you reach the Dubai Desert Conservation Reserve, the tour turns safari, African-style. The camels that take you back to your Arabic tent in the evening are an extra special touch, and the early morning hot air balloon flight is a magical experience.

Steph Koyfman

Shannon McMahon

Charlie Hobbs

Dune Riders (Adventure Unlimited) by Dream Explorer Dubai Arrow

Adventurous travelers make up this tour’s tribe. Once you get to the desert, there’s a swift safety briefing and then you’re off: dipping and diving over sunburnt sand dunes, some of which lie at a stomach-dropping 90 degree angle. The trip happens in convoy, so there’s no need to worry about ending up lost in the middle of the desert. An hour of sand boarding adds extra thrills.

Quad Bikes Safari by Red Dunes Desert Safari Arrow

There’s nothing quite like charging over dunes and across the desert on your very own quad bike. Everyone is picked up at the hotel, and driven 30 minutes to the quad biking spot in the desert. While this certainly isn’t the most luxurious, or in-depth desert safari, it’s ideal for anyone who wants to experience local Arabic culture and have a bit of adventure on a short time frame.

Hummer H2 Safari by Sand Trax Dubai Desert Safaris Arrow

This four-hour tour begins with a hotel pick up in a huge white Hummer, which will whisk you out to the desert. Drivers are super organized and run you through the itinerary: thrilling dune drive, photos at sunset, a barbecue dinner, belly dancing, a dizzyingly good whirling dervish, shisha, and Arabic coffee so strong your spoon stands upright in it. Most people do desert safaris in a Land Cruiser, so the experience in a Hummer is completely different, and novel.

Desert Safari by Arabian Nights Tours Arrow

The adrenaline charge that bumping over the steep sand dunes gives you is amazing, but it’s the post-drive camp time that really stands out. Rather than the usual all-you-can-eat buffet and barbecue, this camp offers shawarma – a typical Arabic dish of ground meat, falafel or chicken with vegetables and fries, served in a wrap. There are opportunities to get henna tattoos or watch a belly-dancing show, or just spend time with friends at the table, before being driven back to your hotel.

Morning Desert Safari with Sand Boarding by Arabian Expedition Arrow

If you get to bed early, a desert safari in the morning is rather special – and this one with Arabian Expedition is one of the best. The drive over Dubai’s undulating dunes is fun, with experienced drivers navigating some hair-raisingly steep drops. Once you've caught your breath there’s sand boarding, with a guide showing you to how whizz down the slopes.

Desert Safari by Adventure Leisure Tourism Arrow

Adventure Leisure Tourism offers plenty of safaris, but their straight up desert safari is by far their best—and the range of activities included is far more eclectic than most. This activity-led tour will take guests dune bashing, on a camel ride, and through a whirlwind of cultural experiences, with a variety of shows you won't see elsewhere. For an extra fee, guests can add quad biking to the mix.

Flying Carpet with Dinner for Two Safari by Orient Tours Arrow

This romantic tour runs on request for parties of two. Things kick off with a dune drive in one of their luxury Jeeps, before you’re taken to a very impressive lump of sand for a sand-boarding lesson. A local camel farm follows, and finally a well-deserved private barbecue dinner at a desert camp, with performances. The pre-dinner falcon show is great, but it’s the whirling dervish performance that really captured our imagination.

Sunrise in the Desert Safari by Tribal Trail Tourism Arrow

Anyone wanting a personalized tour will love Tribal Trails’ early morning take on the desert safari. This tour is popular with families and older travellers who rise early, but are still up for an adventure, and the option to request a private car is part of the appeal. Drivers are attentive and kind, and safety conscious: a boon when navigating the rollercoaster-like dunes, and when strapping guests into sandboards.

Premium Sundowner Dune Dinner Safari by Arabian Adventures Arrow

A desert safari is one of the best things to do in Dubai, and this is the crème de la crème. Jump in the Land Rover and make for the desert, where you’ll get to experience a sunset dune drive in the Dubai Desert Conservation Reserve (knowing a portion of your ticket goes to conservation). A glass of bubbly calms any post-dune-bashing nerves, as does kicking back on Arabian-style blankets with a shisha pipe. Of course, don’t forget to enjoy the dinner: an Arabic-style buffet and barbecue that are well worth writing home about.

Exclusive Morning Safari by Funtours Arrow

A cheerful morning pick up sets the tone for this family-friendly tour. Guides are smiley and informed – and they’re great drivers, too. There’s a definite game plan, with exactly 20 minutes of dune driving, followed by a camel ride and a short but sweet sand boarding session. Ideal for anyone with a short window to experience Dubai’s desert, this tour checks all the boxes.

Evening Red-Dunes Desert Safari Dubai by OceanAir Travels Arrow

This full-day desert safari packs adventure in, making it possible to experience the best of the desert in just a day. The dune bashing is great, but it’s the sand surfing that’s the real highlight. Guides show you how to soar down the dunes, before everyone piles back into the Land Cruiser and heads to the desert campsite. Anyone with leftover energy can head to the camel rides, but there’s henna painting and shisha pipes waiting on the colorful Arabian carpets, too.

Recommended

By signing up you agree to our User Agreement (including the class action waiver and arbitration provisions ), our Privacy Policy & Cookie Statement and to receive marketing and account-related emails from Traveller. You can unsubscribe at any time. This site is protected by reCAPTCHA and the Google Privacy Policy and Terms of Service apply.

We are open. Call 01706 770150 , chat or visit us .

Rainbow Tours

As one of the UK`s leading Independent Operator, Rainbow Tours is honoured to be working with Designer Travel.

Our Top UK Agent in the North in 2015 and a preferred partner, the Designer Travel Team live and breathe our core values; Passion, Inspiration, Genuine and Excellence. Their attention to detail and service is unrivalled and we have enjoyed a longstanding relationship and look forward to many more in the years to come.

Since 1974 the Inspiring Travel Company has been at the forefront of creating bespoke travel experiences worldwide.

We‘re proud to be an independent business, which means our reputation is built on providing absolute excellence from start to finish and we take care of all the little details that will make your holiday something truly special.

Pioneers of responsible travel, Rainbow Tours specialises in tailor-made holidays, and offer a selection of small group tours to Africa, Madagascar and Latin America.

Whether you are seeking a trekking adventure to Machu Picchu, wanting a relaxing beach break coupled with wildlife encounters, or wishing to witness a thousand thundering wildebeest stomping across the savannah, our passionate travel experts can turn needs and interests into bespoke tailored tours.

Unique Services

• Over 40 years expertise as a group in creating travel experiences
• We’re independent, we only feature what we believe to be the best for customers
• Direct contracts with suppliers gives us complete control
• We care deeply about providing exceptional service and value for money
• Award-winning pre-travel Concierge service
• The support of round the clock Duty Management

Take A Journey With Us:

Tel: 01706 770150

Email: [email protected]

Holiday Types

Touring Holiday

Tailor-Made Packages

We'll call you back

Leave us your contact details and we will be in touch.

Newsletter Signup

You can unsubscribe at any time. Please see our Privacy Policy .

COUNTRYPICKERWESELECTEDHEADERMESSAGE

COUNTRYPICKERWESELECTEDMESSAGE click here

Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here

Choose your country and language

• The Americas
• The Middle East
• Asia & South Pacific
• All Inclusive Offers
• Athens Vacations
• Early bird offers

Dubai Vacations

• Last Minute Escapes

Maldives Vacations

• Milan Vacations
• Upgrades & More

Featured Destinations

Middle east.

• Ras Al Khaimah

Indian Ocean

• Philippines
• South Korea
• South Africa
• All-Inclusive Vacations
• Beach Vacations
• Business Class Vacations
• Family Vacations
• Ultimate Luxury
• Wellness Vacations
• Egypt - Splendours of the Nile
• India - Golden Triangle Tour
• Italy - Milan and Lake Como
• Jordan - Jordan Explorer Tour
• South East Asia
• Sri Lanka - Serendib Explorer
• COVID-19 Hub
• Pay My Balance
• 1-855-358-1505
• Flight + Hotel

Search Holidays

• Manage My Booking

Introduction

At a glance, when to visit, what to pack, areas of dubai, attractions.

The speed of Dubai’s metamorphosis is unparalleled, creating a thriving metropolis in the heart of the desert in less than half a century. Many people are likely to be dazzled by the whiteness of the sand and the scale of the skyscrapers, but it’s also still possible to step back in time with a desert safari or boat trip on the creek.

Dubai vacations are even more memorable, when you are soaking up the sun on the beaches of Dubai or enjoying limitless culinary delights in award-winning Michelin starred restaurants, some with awe-inspiring iconic views of the city or watching your sporting heroes take part in some of the most prestigious international sporting events around the year. Alternatively, shop till you drop in any one of Dubai's 96 malls or souks. Be there in Dubai for the vacation of a lifetime.

If you're looking to relax completely, knowing that everything is taken care of even before you travel, we recommend a Dubai all-inclusive vacation! With all your meals and drinks paid for, when you book these offers with Emirates Vacations, you can look forward to a stress-free holiday in the sun.

Book today and enjoy guaranteed savings , low deposits from $199, complimentary upgrades and many more extras to make your next vacation truly unforgettable. Call us on 1-855-358-1505 for further details and to book.

Emirates gateway: Dubai International Airport

Time zone: GMT + 3 hours

Currency: Emirati Dirham. Currency is easily exchangeable beforehand. ATMs are plentiful and credit cards widely accepted

Languages: Arabic, with English is widely spoken

Dialing code: +971

Religion: Islam

Plug sockets: 240 volts AC, 50Hz. British-style plugs with three pins are standard

Transfers from Dubai Airport to Dubai City: 20 to 30 minutes

Transfers from Dubai Airport to Jumeirah Beach/Jumeirah Beach Residence: 40 to 50 minutes

Transfers from Dubai Airport to Palm Jumeirah, Jebel Ali or desert: 50 to 60 minutes

From beaches that fringe the warm waters of the Arabian Gulf bathed in year-round sunshine, to the architectural marvels that punctuate the skyline and define the destination, Dubai is irresistibly dynamic, with some of the world’s most unique and modern attractions.

• Wander the laneways of the atmospheric gold and spice souks of old Dubai, piled high with aromatic and glittering treats.
• Check out super-cool Kite Beach if you’re into watersports.
• Have hours of laughs and squeals while cooling down at Dubai’s water parks.
• Visit Downtown Dubai, packed with incredible sites, including an actual dinosaur skeleton inside a shopping mall and the highest building on the planet, Burj Khalifa.

Expect year-round sunshine – it’s just a case of exactly how hot you like it. October to April provides the most pleasant option (small potential of rain and wind in January and February), with temperatures around 25-28C. From May, these temperatures really rocket between June and September (upwards of 40C) but Dubai offers plenty of incentives to visit then, such as shopping festivals in air-conditioned malls, indoor attractions and fantastic value offers.

These high temperatures require light, breathable clothing, but always have a cover-up for when you hit the air conditioning. Whilst a liberal and popular holiday hotspot, it’s still good to bear in mind that Dubai is a Muslim destination, so dress respectfully outside of your resort (for example, women should wear clothing that covers the shoulders and the knees in shopping malls, and if entering a mosque, hair must be covered). Desert trips are best in comfortable safari-type clothing.

Palm Jumeirah

This ambitious artificial archipelago, created using land reclamation, was one of many projects that put Dubai on the map, with its crescent-like “fronds” extending out from a “trunk” that runs the length of the central section – all the way from the mainland up to Atlantis The Palm. The 5.4km Palm Jumeirah Monorail also runs from the Gateway Towers at the base to Atlantis The Palm and is home to many thousands of private homes, and numerous hotels by some of the world’s leading brands, such as Fairmont, Sofitel, Jumeirah, One&Only, Waldorf Astoria and Anantara.

Jumeirah Beach

One of the original homes of tourism here in the emirate, Dubai’s main beach area is washed by the warm waters of the Arabian Gulf and lined with excellent hotels, such as the iconic wave-like Jumeirah Beach. Also here is Wild Wadi WaterparkTM, which will keep everyone amused for hours, while Jumeirah beach park is a great public space that’s also popular with local families.

Downtown Dubai

The anchor of this futuristic district is the Burj Khalifa, the world’s tallest building, which took five years to build and opened in 2010, boasting a staggering 828 metres to its name; from the viewing area at its upper levels, other buildings below seem like crumbs. Inside the Burj Khalifa is the first-ever Armani hotel, while other attentiongrabbing attractions of this area include Dubai Mall and Dubai Fountain - both the world’s biggest - where jets of water shoot up to 150 metres high, and seem to “dance” in time to music as they are illuminated by more than 6,000 lights.

Sitting on the south side of Dubai Creek, the oldest part of the city dates to the 1900s, with sandy-coloured buildings, museums and minarets. Here you’ll see Al Fahidi Historical Neighbourhood with its charming car-free, narrow streets and houses topped with wind towers, or barajeel. The area was previously known as Bastakiya after the Iranian town of Bastak, where the original Iranian settlers came from across the Gulf to take advantage of free land and low taxes. You can find out more about Dubai’s history with a look inside Dubai Museum or browse the rainbow of fabrics, clothes and slippers in the Textile Souk.

Sheikh Zayed Road

Named for the much-revered first president of UAE, this is where life has spread out to from the Creek, and has been the epicentre of development, amassing a collection of skyscrapers each more audacious than the next, such as Emirates Towers. Technically, it’s just part of the highway running across the whole of UAE, but it’s also where you’ll find many of the city’s hotels, restaurants and shops. For example, just some of the junctions off here will take you towards Mall of the Emirates, Gold & Diamond Park, Madinat Jumeirah, Burj Al Arab, Wild Wadi Water Park™, Downtown Dubai, Burj Khalifa, Dubai Mall and Dubai Marina.

Wander one of the city’s oldest districts, dating to around 1841. Once just a sleepy waterside village, Deira soon took over the original settlement of Bur Dubai in scale and is still a cornucopia of ethnicities mixed with tourists, here to check out the souks, where gold is among the cheapest in the world. You can cross Dubai Creek between Deira and Bur Dubai in an ‘abra’ (water taxi) for just AED2 (approximately 40p).

Dubai Marina

Sophisticated, skyscraping, and buzzing – Dubai Marina is designed to evoke Riviera-style living in a contemporary setting. This attractive and central place to play and stay in Dubai is a waterfront development built around a 3.5km canal. Along its banks are Dubai Marina Mall (with around 140 stores); The Address Dubai Marina hotel; Pier 7 Dubai Marina - which boasts seven restaurants, each on its own floor and with a unique atmosphere; and Dubai Marina Yacht Club.

Mall of the Emirates/Al Barsha

Now 11 years old, this place changed the face of shopping in Dubai forever. Billed as the world’s first shopping “resort”, it is a destination in its own right, home to Ski Dubai, hundreds of shops, two hotels including Kempinski Mall of the Emirates, Magic Planet for family entertainment, a 14-screen VOX Cinema, Dubai Community Theatre and Arts Centre and more than 90 dining options. Al Barsha the residential area surrounding the mall offers affordable accommodation and local dining options close to many of Dubai’s key attractions.

No trip to Dubai would be complete without a desert safari. Hop into a 4x4 and leave the city behind as you head into the wilds of the desert - go dune ‘bashing’ or camel-riding before sunset, then enjoy remote Bedouin-style camps with fireside tales and delicious dinners, or even spend the night sleeping out in tents before returning to Dubai after breakfast.

Jumeirah Beach Residences

This area combines casual outdoor living with top-notch shops, restaurants and the beach. The Walk at JBR, which was Dubai’s first outdoor promenade, has a 1.7km stretch of shops and restaurants and more recently has also been joined by The Beach, with even more dining and leisure options formed around a pedestrian esplanade.

Jebel Ali is the thriving commercial port area of Dubai, around 35km southwest from the city, and given its historic establishment, can also boast one of the most longstanding and largest resorts in the emirate – the JA Jebel Ali Beach Resort, which has a lovely private beach, golf course and a myriad of other leisure attractions. Jebel Ali is also the new home of a dazzling new attraction - Dubai Parks & Resorts. This is the first integrated resort destination in the region, opening in late 2016, and home of LEGOLAND® Dubai, LEGOLAND® Waterpark, motiongate™ Dubai and Bollywood Parks™, as well as Riverland™.

International restaurants and top global chefs are in abundance, but if you want to try Emirati cuisine, you’ll sense a range of regional influences. Most likely, you will find roast lamb with rice and nuts (ghuzi), stuffed vine leaves (warak enab), chickpea and sesame paste (hummus), bulghur wheat with mint and parsley (tabbouleh), spit-cooked meat in pitta bread with garlic sauce (shawama), cooked balls of chickpeas with herbs (falafel) and plenty of fish. Goat may also be on the menu, but no pork, in accordance with Muslim beliefs. Alcohol is tolerated and drinking is possible in the plentiful hotel bars and restaurants.

Culture in Dubai is rooted in Islamic traditions. Emirati men tend to dress in traditional dishdasha or khandura (long white shirt-dress), with ghutra (a white headdress) and agal (a rope worn to keep the ghutra in place), while women tend to wear an abaya (a long black cloak), with a sheyla or hijab (a scarf used to wrap around the face and head). The most religious time of the year is Ramadan, when Muslims fast for approximately a month and a festival atmosphere can be found in the evening when the locals break their fast. But as well as the minarets of mosques, you will also see temples and churches. A new opera house is also set to open this year.

Hares and lizards - such as the spiny-tailed lizard - may scamper around the desert but you would be hard pushed to see much natural wildlife in Dubai these days. However, there are many excellent reserves and conservation projects you can explore – which provide the thrill of seeing the iconic oryx, an Arabian leopard, mountain gazelle, sand gazelle or caracal. In the waters, you might have the chance of spotting the biggest fish of the ocean, a whale shark.

The human history of Dubai dates back to the bronze age (2500BC) when nomadic cattle herders are first thought to have settled in the area. A couple of millennia later and Dubai was still little more than a small fishing settlement until members of the Bani Yas tribe, led by the Maktoum Family, settled at the mouth of the creek in 1833. The creek was a natural harbour and Dubai soon became a centre for the fishing, pearling and sea trade. The population was later buoyed by the lure of tax-free living attracting traders from the Indian subcontinent. Oil was discovered in the 1950s and the first cargo left Dubai in 1969. In 1971, the six emirates agreed a Federal Constitution, gained independence from Britain becoming the United Arab Emirates, with Ras Al Khaimah joining the following year to form the UAE as it is today.

Aquaventure Waterpark

This adrenaline-pumping waterpark set within Atlantis The Palm includes the chance to take the Leap of Faith or zoom through the darkened tunnels of Shark Attack; as well as an invite to tackle Aquaconda, the world’s largest water slide. Or, perhaps you prefer to just sit and mind everyone’s towels as you relax on 700 metres of private beach. Ticket prices from E£ 1,253 per person.

At The Top, Burj Khalifa

This attraction is spread across levels 148 and 125 of Burj Khalifa, the world’s tallest building. The experience starts with the lift up to level 125, where you can marvel at the view from the 380-degree enclosed observatory. Then it’s up a little more, to the 148th floor at 555 meters, where you step onto the world’s highest outdoor observation deck. After all that sightseeing, visit Level 122 which is home to the restaurant and bar, At.mosphere. Ticket prices from E£ 797 per person.

IMG Worlds of Adventure

Dubai’s first mega themed entertainment destination will be the largest temperature controlled indoor park in the world and will wow guests with its four epic adventure zones. Two are created with global adventure brands Cartoon Network and MARVEL, while IMG Boulevard and the Lost Valley – Dinosaur Adventure are original concepts from the IMG Group. Think rollercoasters, thrill rides and attractions – all based on popular characters and hair-raising dinosaurs. Combine with the amazing array of retail temptations and exclusive dining venues and you have a day of fun for the whole family.

The brilliant KidZania® is a super-interactive and educational attraction inside The Dubai Mall where children play grown-ups as they try on various careers for size. There are more than 80 roles to choose from including firefighters, radio hosts, jewellery designers and mechanics. Ticket prices from E£ 683 per person.

Wild Wadi Waterpark™

One of the best family days out in Dubai, Wild Wadi Waterpark™ is set in front of the iconic Burj Al Arab Jumeirah, and offers 30 watery rides and attractions. Themed around the tale of Juha, a character from Arabian folklore, the rides range from sedate “lazy rivers” where you can bob along in a rubber ring, to the Jumeirah Sceirah, which has two tandem slides you zip down from a 32 metre high tower.

Dubai Aquarium

The 270-degree acrylic walkthrough tunnel takes you under one of the largest tanks in the world so you can see some of the 33,000 animals - representing more than 85 species including 400 sharks and rays. You can also just stroll past it from The Dubai Mall, with one of the world’s largest viewing panels to gaze through to the aquarium. Ticket prices from E£ 456 per person.

Seawings Seaplane Tours

There’s only one way to really get to grips with the scale of things here - from the air and these tours by seaplane do just that. Giving the finest views over Dubai, these comfortable little planes can use 27 different water landing strips and runways across UAE, so any combinations can be arranged. The 40-minute Dubai Silver Air Tour flies you over all the Dubai classics, taking off from either Dubai Creek or Jebel Ali Resort, then cruising along the coastline, giving you a bird’s-eye view of The World, Burj Khalifa and Burj Al Arab Jumeirah. Ticket prices from E£ 8,109 per person.

Situated within the Mall of the Emirates, this made the world sit up and take notice of Dubai’s many ambitious projects when it first opened – and still does. It was the Middle East’s first indoor ski resort and today offers a snow park, Ski School, Penguin Encounter and Snow Bullet. Ticket prices from E£ 615 per person.

SEGA Republic

One of the many attractions inside The Dubai Mall, SEGA Republic is a high-adrenaline, indoor family theme park, featuring 15 attractions and more than 170 games, from cutting-edge motion simulators to virtual experiences. Ticket prices from E£ 820 per person.

Dubai Parks and Resorts

Calling all adventure seekers, Dubai Parks and Resorts opened its doors in October 2016 and should be at the top of your must-visit list. Home to three world-class theme parks, one water park and over 100 attractions ranging from rollercoasters and waterslides to cinematic rides and live shows, Dubai Parks and Resorts is sure to delight guests of all ages. Lapita, a four star Polynesian style hotel is located within the parks and offers guests the convenience of a night’s rest only a few minutes from the rides. Located on Sheikh Zayed Road, opposite Palm Jebel Ali, a trip to this fun-filled resort is a great option for guests staying in Dubai or Abu Dhabi.

More To Discover

If you want to do more than “fly and flop”, you’ve come to the right place. One way to get the measure of Dubai is to catch it from the air – whether that be via an adrenaline-fuelled skydive over The Palm Jumeirah, or a scenic seaplane ride. Other aerial options include a sunrise hot air balloon experience, which will lift you off the ground 1,200 metres above the desert as you spot oases and the occasional wandering camel below. Kite surfers will love Kite Beach, one of Dubai’s best stretches of sand, and one where watersports operators aplenty await to help you pick up a new skill or hone your talent. Meanwhile at Dubai Mall, you can try a snorkeling cage experience within the huge tank at Dubai Aquarium, or even swim with sharks.

Explore more Indian Ocean Holidays

Mauritius Vacations

Seychelles Vacations

Sri Lanka Vacations

Join the emirates vacations community.

Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.

We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.

Why Emirates Vacations?

• Personalised holidays
• Support at every step
• Get more for your money
• Fly Better with Emirates

For more information, please click here

• Recent Hotels 0 You do not have any recently viewed hotels.
• Shortlist 0 Your hotel shortlist is empty!
• Recent Searches You do not have any recent searches

Please refresh this page

This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.

• Price-list   (PDF)
• All UAE Tours & Activities...
• Dubai Tours, Trips & Activities
• Dubai Desert Safari , Air Tours , City Tours , Sightseeing , Excursions , Fishing , Boat Trips , Family , Kids Activities , Luxury , Private , Day Trips , Night Tours , One Day , Half Day , Adventure , Extreme , Water Sports
• Adventure , Excursions , Sightseeing , Fishing , Boat Tours , Luxury , Private , Day Trips , One Day Tours , Half Day , Indoor Activities
• Sharjah Desert Safari , Sightseeing , Fishing , Kids Activities , Boat Tours , Luxury
• Desert Safari Ajman , Sightseeing , Fishing , Kids Activities
• Sightseeing , Fishing , Day Trips , Kids Activities
• Ras Al Khaimah
• Sightseeing , Excursions , Fishing , Day Trips
• Umm Al Quwain
• Sightseeing , Fishing
• All Tickets in Dubai...
• Dubai Indoor Activities Dubai Shows & Entertainment Dubai Theme Parks Dubai Viewpoints Dubai Water Parks
• All Tickets in Abu Dhabi...
• Abu Dhabi Indoor Activities
• Boat Tours / Yachts ❯
• Dubai Dhow Cruises , Marina Dinner , Creek Dinner , Day Cruises , Dubai Night Cruises , River Cruises , Private Boat Tours , Yacht Rental
• Fishing in UAE (United Arab Emirates)
• Fishing in Dubai
• Fishing in Abu Dhabi
• Fishing in Sharjah
• Fishing in Ajman
• Fishing in Fujairah
• Fishing in RAK (Ras Al Khaimah)
• Fishing in Umm Al Quwain
• Diving / Snorkeling ❯
• Diving Deep Dive Dubai Snorkeling
• Spa & Massage
• Dubai Taxi Service Taxi Dubai ↔ Abu Dhabi Taxi Dubai ↔ Sharjah Rent a Car with Driver in Dubai
• Hotels Search
• Airline Tickets
• Online Support
• PDF  Price List    All Tours & Activities Desert Safari Air Tours City Tours Sightseeing Excursions Fishing Boat Tours Family Kids Activities Luxury Tours Private Tours Day Trips Night Tours One Day Half Day Indoor Activities Extreme Water Sports ">Dubai Tours & Trips
• Dubai Yacht Rental Dubai Dhow Cruises Dubai Dinner Cruises Dubai Day Cruises Dubai Night Cruises Dubai River Cruises Abu Dhabi Sharjah Ajman Fujairah Ras Al Khaimah Umm Al Quwain ">Cruises / Yachts
• PDF  Price List    Dubai Abu Dhabi Sharjah Ajman Fujairah Ras Al Khaimah Umm Al Quwain view all tours & activities... ">UAE Tours & Trips
• Dubai Abu Dhabi Sharjah Ajman fujairah Ras Al Khaimah Umm Al Quwain view all fishing tours... ">Fishing
• Dubai Taxi Service Taxi Dubai ↔ Abu Dhabi Taxi Dubai ↔ Sharjah Rent a Car with a Driver in Dubai ">Taxi
• All Dubai Tickets Dubai Indoor Activities Dubai Shows & Entertainment Dubai Theme Parks Viewpoints in Dubai Water Parks in Dubai All Abu Dhabi Tickets Abu Dhabi Indoor Activities ">Tickets
• Diving Deep Dive Dubai Snorkeling ">Diving / Snorkeling
• UAE - Thailand - Pattaya Phuket Samui Bangkok ">Other Locations

«Rainbow» Dinner Cruise in Dubai Water Canal

Evening boat cruise.

A cruise on the ship "Rainbow" is a good alternative to walking along the embankment. Sitting comfortably on the upper or lower deck, you can watch the nightlife of the coastal part of the city, admire the bright lights and breathe in the sea breeze. Moreover, as part of the walk, you will visit the Dubai Festival Bay, where the IMAGINE laser show is held in the evenings. This unique performance gathers hundreds of spectators every day. It combines laser, sound and water special effects, has been listed twice in the Guinness Book of Records, and it's worth a look for sure! A buffet dinner on board the ship will also be a pleasant addition to the cruise.

Price for Evening Boat Cruise

Cruise schedule

20:00  Getting on board.

20:30  Sailing off.

22:30  Returning to the pier.

Cruise route

The route can be changed by the organizer because of weather conditions and water levels.

• Burj Khalifa
• Dubai Creek
• Flamingo Park
• Business Bay and D1 Tower skyscrapers
• Doe Jadaf Shipyard Dubai
• Ras Al Khor Wildlife Sanctuary
• Creative District D3
• Business Bay
• Festival City Shopping Center and IMAGINE show (laser, light and water special effects)

Additional information

• It is not allowed to bring food and alcohol on board
• Drinking of alcoholic beverages is prohibited on board
• Shows can be canceled for the quarantine period and Ramadan

«Rainbow» Location

The cruise starts from the pier near D1 Tower, Jaddaf.

Give feedback

You may also be interested in.

• Terms and Conditions
• Privacy Policy
• Cookies Policy

Rainbow Private City Tours

• Private transportation
• Entry/Admission - Dubai Creek
• Lunch & Dinner; Burj Khalifa observation deck entrans fee
• Entry/Admission - Dubai Miracle Garden
• Picking up from Hotels, Airport and Cruise Ship Terminals
• Port Rashid
• Dubai International Airport
• Not wheelchair accessible
• Near public transportation
• Confirmation will be received at time of booking
• No heart problems or other serious medical conditions
• Most travellers can participate
• This experience requires good weather. If it’s cancelled due to poor weather, you’ll be offered a different date or a full refund
• This is a private tour/activity. Only your group will participate
• For a full refund, cancel at least 24 hours in advance of the start date of the experience.
• You'll get picked up See departure details
• 1 Dubai Creek Stop: 60 minutes - Admission included See details
• 2 The Dubai Fountain Stop: 3 hours See details
• 3 Palm Jumeirah Stop: 60 minutes See details
• 4 Souk Madinat Jumeirah Stop: 30 minutes See details
• 5 Burj Al Arab Stop: 20 minutes See details
• 6 Dubai Marina Stop: 30 minutes See details Pass by Mall of the Emirates
• 7 Dubai Miracle Garden Stop: 2 hours - Admission excluded See details Pass by World Trade Centre
• 8 Dubai Festival City Mall Stop: 3 hours See details
• You'll return to the starting point

More to explore in Dubai

Rainbow Private City Tours provided by "Rainbow" Private Tours

• Dubai Canal Cruise
• Combo Packages

• +971 52 52 52 746
• Marina Cruise
• Creek Cruise
• Canal Cruise

Rainbow Dinner Cruise Dubai Water Canal

Dubai, a city known for its luxury, modernity, and luxurious experiences, offers visitors many captivating attractions. Among these, the Rainbow Dinner Cruise at Dubai Water Canal stands out as a remarkable blend of culinary delight and scenic beauty, creating an unforgettable evening for tourists and locals alike.

Setting Sail on the Dubai Water Canal

The Dubai Water Canal, a marvel of modern engineering, stretches over three kilometers, connecting the Arabian Gulf with Dubai Creek. The Rainbow Dinner Cruise takes you on a delightful journey along this majestic waterway, providing a captivating perspective of the city’s stunning skyline. As the sun sets over the horizon, the canal comes alive with different colors, reflecting off the water and casting a magical atmosphere over the surroundings.

The Rainbow Dinner Cruise at Dubai Water Canal sets sail from the picturesque location of Al Jaddaf, embarking on a mesmerizing journey that spans some of Dubai’s most iconic landmarks. As you glide along the canal’s peaceful waters, you’ll be treated to an unparalleled view of the Burj Khalifa, the world-renowned Dubai Creek, the Flamingo Park, and the Business Bay and D1 Tower skyscrapers that illuminate the city’s skyline. The route also contains the historic Doe Jadaf Shipyard Dubai , offering a glimpse into Dubai’s maritime heritage. This all-encompassing journey ensures that passengers aboard the Rainbow Dinner Cruise experience the diverse aspects of Dubai’s charm and luxury, creating cherished memories against these captivating sites.

Arabic Mezze Platter

Crispy Calamari

Caprese Salad

Accompaniments

Garlic Buttered Broccoli

Truffle Parmesan Fries

Classic Tiramisu

Mixed Berry Pavlova

Cream of Mushroom

Mocktails and Soft Drinks

Mineral Water

Main Course

Grilled Fillet of Beef

Lemon Herb Grilled Chicken

Seafood Paella

Vegetable Tagine

Embark on a captivating journey with our 2-hour Rainbow Dinner Cruise, where the enchantment begins when you step aboard.

The boarding begins at 8:00 PM, and at 8:30, the cruising starts, and the boat sets to sail in the tranquil waters of the Dubai water canal from where the real adventure begins. After 2 hours of remarkable cruising and delicious dinner, the cruising concludes at 10:30 PM, ending an unforgettable evening.

Price per Person

Embark on a remarkable culinary and scenic journey with the Rainbow Dinner Cruise, available at an unbeatable price of just 59 AED per person. Imagine a two-hour experience that blends delectable dining and breathtaking views along the Dubai Water Canal. With affordability and luxury combined, the Rainbow Dinner Cruise promises an exceptional evening that captures the essence of Dubai’s luxury and beauty, ensuring memories to cherish for a lifetime.

Price per Person: 59 AED Tour: 2-hour Rainbow dinner cruise in Dubai Water Canal

Booking Process

Booking your unforgettable Rainbow Dinner Cruise experience is a seamless process. Visit our official website or contact our dedicated reservation team to secure your spot. Choose your preferred date and provide the number of guests at your party. Once your booking is confirmed, you’ll receive an email containing all the essential details, including boarding time and location. On the chosen evening, arrive at the designated boarding point, present your confirmation, and embark on a captivating culinary delight and scenic beauty journey along the Dubai Water Canal.

You might also like

Star Queen Cruise

Goldfish Dinner Cruise Dubai Water Canal

Leave a reply cancel reply.

Your email address will not be published. Required fields are marked *

Save my name, email, and website in this browser for the next time I comment.

Follow Dubai Cruise

Popular Dhow Cruises

Contact Info

• [email protected]
• 246, 14th floor, Regal Tower, Business Bay, Dubai
• Mon-Fri (9.00 am – 6:00 pm)

More About Cruises

• Birthday Party on Cruise
• Dinner Cruises in Dubai
• Things About Dhow Cruise
• Access to Marina Cruise

Must See Places

• Best Must See Places
• Top Attractions of Dubai
• Desert Safari
• Dubai Marina Walk

Must Do Activities

• Shopping Malls in Dubai
• Activities During Summer
• Visit Burj Khalifa
• Historic & Old Dubai

© Copyright Dubai Cruise - Crafted By Tashheer's Digital

Welcome to Sunny Rainbow Tours

• Destination

• Company profile
• Other Services

Greenway Adventures

Travel and Adventure

Rainbow Valley Spectrum Hike

Rainbow Valley Spectrum hike is located in the Fujairah region, a 1.5-hour drive from Dubai Airport. One of the must-do UAE trails in UAE, This hike is also called Spectrum hike. It features unique multicolored rock terrain and small seasonal pools in the Spectrum View Point, due to the different kinds of minerals that make the rock become different layered colors. It is a true piece of artwork created by nature and delightful sight. No wonder why Rainbow Valley is arguably the most “Instagramable” hike in the UAE. This Hike is labeled in different Levels Beginners to Advance, it’s a kid’s friendly trail up to the first view Point, a Moderate hike distance you may do 6-8 Km. This trail is not marked it involves small climbing, bouldering, loose rocks, and uneven steep rocky slopes. You will have an Ocean view from the top if you choose the advanced trail.

About the Hotel Occupying a central location in the heart of Bur Dubai, Bank Street, the Rainbow Hotel is within easy reach of the Indian Bazaar, the famous Dubai Creek, the Dubai Museum and some of the city�s top shopping malls like Burjuman Centre, Khaleej Centre, Computer Street.�It is situated just a 10-minutes drive from Dubai International Airport and 5 minute drive from Dubai World Trade Centre. � Facilities : Restaurant, 24-Hour Front Desk, Newspapers, Elevator, Express Check-In/Check-Out, Individual Safety Deposit Box, Luggage Storage, Sauna, Fitness Centre, Roof top Swimming Pool, Wireless internet is available in the entire hotel at reasonable cost, Free private parking is possible on site. Child Policy : 2 children below the age of 10 can share the same room with their parents free of charge and enjoy a discount of 50% on the meal rates. Cancellation Policy : Cancellation can be made 2 days prior before the arrival date without any additional charge. All cancellations thereafter or in the event of a No-Show, one night room revenue charge will be applicable.

How to Hike Rainbow Valley (Spectrum) Trail in Fujairah, UAE

Rainbow valley hike in Fujairah Emirate is one of the must-do UAE trails . Also called Spectrum hike, it features unique multicolored terrain and small seasonal pools. Read on about how to hike Rainbow Valley and what to expect on this extraordinary trail in the UAE .

Located 1.5 hours drive from downtown Dubai, in Wadi Ghub, Fujairah Emirate, the Rainbow Valley hiking trail quickly gained its popularity due to the unusual scenery. As the name suggests, there is some color game going on. Layered rocks are “painted” in gradients and hues of reds, greens, whites, browns, oranges, and burgundies, resembling rainbow patterns.

It is a true piece of artwork created by nature and delightful sight. No wonder why Rainbow Valley is arguably the most “ instagrammable ” hike in the UAE.

Spectrum hike has something to offer to all levels of hikers-from beginners to experts. In this post I share everything you need to know about the Rainbow hike in the UAE: how to get there, how far are the colorful rocks located, sections according to difficulty levels, and how to prepare for a safe hike.

Sign up HERE to receive a FREE downloadable quick guide to The Best Hiking Trails in the UAE !

Disclaimer:  This post contains affiliate links, which means that I may earn a commission if you make a purchase by clicking a link (at no extra cost to you). This helps to keep my blog running and grow by creating more awesome free content for you.

Hiking Guide to Rainbow Valley (Spectrum) Trail in Fujairah, UAE

Rainbow valley hike overview and map.

Summary: picturesque colorful layered rocks, a few small seasonal pools (not suitable for swimming),  a lot of large boulders, scree sections towards the summit, almost no shade throughout all the trail.

Distance: 11 KM (6.8 miles) (total distance in and out the same way, can be shortened, or prolonged into a loop)

Duration: 4 HRS moving at a regular pace (2.8KM per hour), but it took us 6 HRS (as we were moving at a very slow pace- 1.8 KM per hour).

Difficulty Level: beginner plus to difficult (depends if you are doing a full trail or just a part of it).

Minimum and Maximum Elevation: 800 M (2625 ft) and 132 M (433 ft).

Elevation gain and loss: 658 M and 658 M (2160 ft).

Mobile network and Internet connection: no connection inside the wadi, the signal picked up at the summit.

Is a guide needed? optional (advisable for the first-timers).

Minimum water requirement: 3-5 liters.

Kids friendly? the first 2 KM can be done by kids, later small kids would need assistance to pass big boulders.

Dogs friendly? only the first couple of kilometers before large boulders start.

How to get to the Rainbow Valley hike starting point? 

Rainbow valley trail is located in Wadi Ghub, Fujairah emirate, UAE. It takes 1.5 hours to drive from Dubai downtown to the Ghub Village and then around 7 minutes ride on an unpaved road to reach the parking spot. Sedan cars can easily reach the parking. 

When driving from Dubai, take E311 or E611 road and then turn to E87 road towards Dibba, Fujairah. 

Note, that the last time I have visited Rainbow Valley, the place around the parking area was destroyed by heavy rains. We had to park around 400 meters earlier and then pass a few farms before we reached the trailhead. Still, there was enough space on the side of the road to leave the car. It is also likely the road leading to the original parking lot (which is immediately at the starting point of the trail) will be fixed at some point.

Exact coordinates of the hike trailhead: 25.579819, 56.186216 (you can also type into Google maps: “Fujairah Adventures Rainbow Hiking Trail”).

The best time to go hiking Rainbow Valley in Fujairah, UAE

The best time to go hiking Rainbow valley is during the winter months: late November to mid-March. During warmer months (October, early November, late March, and April) it is advisable to hike early morning or late in the afternoon.

I would advise against hiking Rainbow valley during the hottest months-May to September.

Wadi Ghul, where Spectrum trail is located, gets really hot. There is barely any shade on the trail (some trees here and there but 95 percent of the path is exposed to the sun). Even in mid-November, it was quite hot in Rainbow valley. 

During warmer months, there are better alternatives for hiking in the UAE, such as Wadi Naqab where you can enjoy shaded trekking. 

Related Reads: when the weather temperatures rise in the UAE, hike trails that provide more shade. Check my post about the beautiful Wadi Naqab to wadi Koob and Al Sanat Village hike .

Difficulty level and terrain of Rainbow Valley hike 

While Rainbow valley hike is suitable for beginners, the further into the valley you hike the harder the trail becomes. 

The terrain at the start of the hike is mostly gravel and sand paths, a couple of short sections of small-sized boulders. Therefore beginners can easily hike this section. Later on, large boulders and big rocks become the main attribute of the trail and often require hands to climb over them.

Some of the rocks are quite high (2meters plus). That being said, basic climbing skills are necessary. To me, climbing up is usually easy, but it is totally different game when it is time to climb down. 

Moreover, the section of the route leading to the summit is mainly loose rocks and scree which require extra caution and the ability to trace unmarked trails. 

Spectrum trail is well marked for the first 4 km but afterward, cairns (stone piles used for marking hiking trails) become more and more sparse. 

Therefore, if you decide to do the full 11km trail up to the summit and back, you can expect hiking to be moderate plus or even difficult, depending on how experienced a hiker you are. You have to be confident in climbing large boulders and steep hills over the loose rocks without a clear path. 

Note: ropes are not needed for the Rainbow valley trail.

Spectrum hike divided into sections

To easily understand the path, I have divided the Rainbow valley trail into 3 sections. Below I describe each of those and provide distances and estimated time needed to complete each of them. 

1. Easy section leading to the start of the colorful rocks

Distance: 2 KM (1.24 miles).

Time: 40 min to 1HR (depends on your speed) 

Difficulty: easy (some may say easy plus due to some loose rocks and big boulders at the end of this section)

Elevation gradually reaches 290 m.

If you are looking for an easy trek where you can also take some cool Instagram-worthy hiking pictures of the colorful rocks, the good news is that they are reachable in less than an hour of light hiking. The only hardship you may face is if it is a very hot day.

At the very beginning of the trail, you will pass a military surveillance camera and a small section of boulder immediately after. The first 2 kilometers are relatively easy. You will be walking in the valley with gravel grounds, sandy mountain paths, with a little bit of elevation gain, and some small-sized boulders here and there. 

Yet at the end of this section, immediately before the colorful rocks, bigger boulders make their presence. You will have to climb them to get close to the rainbow rocks. Something to bear in mind for those with a fear of heights or who are not used to climbing.

As a matter of fact, the spot where rainbow rocks start gets really packed during the weekends. But do not worry, the best is waiting for you ahead, and many people do not bother going much further.

2. Hiking through the rainbow valley will lots of bouldering

Distance: 2 KM (1.24 miles) (from spectrum rock, or 4KM (2.5 miles) from the trailhead). The total from the trailhead round trip is 8km (5 miles).

Time: 1-1.5 HRS (one way from spectrum point). The total time to complete two sections of return (8km) is around 3-4 hours. 

Difficulty: moderate.

Elevation gradually reaches 492 m.

This is my favorite section of the hike because it has the best scenery and lots of fun climbing over the rocks. The terrain is very dynamic and you will always be surprised by the ever-changing views of the layered rocks. 

Most of the hikers stop at section 1 and only a few continue further into the valley. Having fewer people adds to the adventure as the place starts to feel more remote and wild. 

Following the trail is still straightforward as you are walking through the wadi. There are plenty of cairns to help you navigate easily. 

Note: this section has several spots with quite huge boulders. You will need both hands to climb up and down. Some of the rocks have a very good grip which makes climbing easier. However, some are quite smooth and slippery. Therefore, you have to be careful and confident in your ability to climb them. 

Towards the end of this section at around 3.5km (2.2 miles) into the hike, you will reach a very beautiful place that looks like a small canyon with wavy rocks on the right-hand side. There you will also approach a high rock wall (probably around 4-5 meters (15 feet)).

You have to climb it from the right-hand side towards the left. The rock is leaning at an angle and is smooth. It may seem tricky at first but there is some sort of a crack that helps as a grip when climbing. It won’t be as hard as it may first seem to be.

Rainbow valley finishes after this rock (it is also the highest bouldering spot in the trail). The terrain then changes- oath doesn’t have so many boulders anymore. Instead, there are lots of loose rocks. 

Therefore, you can either finish with the climb and go a little bit forward for different scenery or continue all the way up to the summit. 

3. Summit hike section

Distance: around 1.5 KM (0.9 miles) one way.

Time: 1 HR to reach the summit of 800 meters. The total time to complete a full trail round trip of 11 KM (6.8 miles) will be 5-6 Hrs.

Difficulty: moderate to hard as there is no marked trail and lots of loose rocks and steep incline.

Elevation quickly reaches 800 m (2624 ft) (can be extended to 1000 m (3280 ft)).

The last section of the hike leads to 800 meters summit (can be extended to 1000 meters (3280 ft).

This part of the hike is poorly marked, with only a few cairns here and there left by other hikers. It is completely off the beaten path and recommended only for the more experienced hikers who know how to trace safe paths in the mountains. 

The terrain is mainly loose rocks, with a few small patches of rainbow rocks appearing randomly. Extra care should be taken closer to the summit, as it gets significantly steeper, with lots of scree slopes. Therefore, make sure to choose a safe path. Cairns will completely disappear close to the summit (or at least we were not able to spot any around 200 m (656 ft) to the summit). 

Scenery-wise, it is not as spectacular as the rainbow valley. However, if you are looking for an adventure, a little bit more challenge for the day, and a longer trail, then go for it. 

As mentioned before, you can reach up to 1000 meters in elevation. From the highest point, you will be able to see the mountains of Dibba, Fujairah, and even Musandam peninsula on a clear day. We only went up to 800 meters above sea level and returned the same way because we didn’t want to be caught in the dark on our way back. 

There is an option to do the 3rd section in a loop before merging back to the Rainbow valley part. However, it is even more challenging due to lots of scree, ridges and steep decline, and sun. We decided to skip the loop as the views didn’t seem to justify the effort and possible risks. If you are keen to do the loop of 15 KM (9.3 miles), the trail was recorded by a fellow hiker on the Wikiloc app .

How to prepare for Rainbow Valley (Spectrum) hike in Fujairah

Hiking in barren UAE mountains always requires being well prepared. The rough terrain and hot climate can be unforgiving, especially during hotter months.

Here is a checklist of what to bring to spectrum hike:

• 3-5 liters of water which crucial for any hike. For the UAE where the weather is hot all year round, alwyas take extra than you think you may need.
• Lightweight power snacks like dates, bananas, protein bars. Also, electrolyte drink aside from water makes wanders during long sweaty hours.
• Sturdy footwear with good grip . The terrains are rough and rocky. Therefore, it is very important you are wearing shoes, ideally mid-ankle height, that have good grip. It will prevent you fromslipping and twisting your ankles.
• Comfy and functional backpack . For a half-day hike you don’t need much supplies to fit in. Still, a backpack with a good back support and, ideally, a space for water bladder, makes a difference. Check out this Osprey backpack chich is great for day hikes.
• Get a water bladder if you are planning to make hiking a regular acitivty. Water bladder has a straw. This means you don’t have to remove your backpack when you want to drink water. Also, water, when filled in the bladder, is evenly distributed in the backpack. I use my two or three liter camel backs (depending on how long the hike is). You can check prices here on Amazon .
• Sunsreen, cap and sun glasses.
• Comfy sweat wicking clothes. I usually hike in gym or hiking leggings and t-shirts. For winter months, I also take a lightweight fleece as mornings and evenings can be chilly in the mountains.
• Hiking poles. It is not a must but very helpful for the descending part. It can be quite tough for the knees when climbing down. For the light weight foldable trekking poles check this pair at Amazon .
• Basic first aid kit. Terrains are rough and sometimes mini injuries can happen. Even as simple as getting a blister. So having plaster for this type of emergency can really make or break your hike.
• Power bank to keep your phone charged.
• GPS device or a Wkiloc app with an accurate trail recording. Check Garmin GPS device on Amazon .
• A rechargeable torchlight in case you end up hiking in the dark. If you want to keep your hands free, then a powerful rechargeable headlamp is a perfect solution.

Other things to be aware of when hiking in the UAE

Goats are the most common animals you will see in the mountains of the UAE. They are usually afraid of humans, and only sometimes you may find them approaching you because they are expecting a snack. Although tempting, it is advisable not to feed animals on the hikes so they do not become dependent on people giving them supplies.

Snakes. They usually come out at night and hide in bushes and under the rocks. Snakes won’t attack humans unless they cause a threat by accidentally stepping on them. Therefore, always be mindful of your steps. I have seen snakes only a couple of times while hiking, but they are quite common in mountainous areas, as well as in the desert.

You can also see and hear bats if you are spending the night in the mountains.

Donkeys are also common if you are passing functional mountain villages.

• Running into darkness while on a hike .

To avoid running out of light, always aim to start your hike early morning. Unless you are planning to camp, estimate your abilities to come back before it gets dark.

• Rain and flash floods

Be aware of the sudden rain. In the UAE rain might cause dangerous flash floods, especially in the wadis (gorges). It is not advisable to hike when it is raining also because rocky terrain becomes very slippery, there is a chance of falling rocks as well.

• Dehydration

Always take extra water, even if it means carrying a heavier load. UAE climate is extremely hot and chances of dehydration are high if you don’t drink a sufficient amount of water.

I hope this guide inspired you to hike beautiful UAE mountains! If you have any questions, please feel free to get in touch.

STAY SAFE ON YOUR HIKE AND KEEP THE NATURE CLEAN!

MY HIKING PHOTOGRAPHY AND VIDEOGRAPHY GEAR

I often get asked about the photography gear I use during my hikes. The reality is, my hiking bag is usually quite heavy because I carry all sorts of equipment in my backpack. Here is what I use to capture my adventures and the beauty of the mountains:

• Photo and video camera: Mirrorless Nikon Z6
• Main lens: Nikkor Z 24-70 mm f/4
• Wide-angle lens: Nikkor Z 14-30 mm f/4
• Drone: DJI Air 2s
• Pocket-sized camera: DJI Osmo Pocket 2
• Small Tripod: Gorilla Pod
• Travel tripod: Manfrotto Element Traveller Tripod (Ball Head)
• Photo and Video Editing software: Adobe Photoshop , Adobe Lightroom and Adobe Premier Pro

DUBAI, UNITED ARAB EMIRATES TRAVEL RESOURCES

Planning your trip to Dubai, United Arab Emirates soon? Below are some useful links to help organize your trip.

• Find the  BEST FLIGHTS  within your budget to Dubai using  KIWI.com  – a booking site that offers the best routes and flight deals (with a money-back guarantee if you miss your connection).
• Rent your wheels at the best rate with  Discover Cars or Myrentacar –  a car search  aggregators that compare prices across local and  international car rental companies.
• Find your  PERFECT ACCOMMODATION  in the UAE on  Booking.com , Expedia , or  Hotellook  (the latter provides the best price comparisons across the biggest hotel search sites).
• Remember to always get  TRAVEL INSURANCE  for peace of mind. Check trustworthy SAFETY WING for the best rates. It also offers Covid related events!  
• Book the best-rated  day tours  in  the UAE  on  GET YOUR GUIDE .

Hi! I am a freelance photographer & videographer as well the creator of www.theroadreel.com. Born in Lithuania, and currently residing in the UAE, I have been traveling around the globe independently for over a decade. I created The Road Reel to share my passion for travel and photography through detailed road trips and city itineraries, and hiking guides, along with regular and drone photogragraphy tips.

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

Save my name, email, and website in this browser for the next time I comment.

We make Trade Fair Tours Hassle-Free and More Effective

More than 17 years of expertise in managing trade fair tours worldwide, more than 5000 happy and repeated travelers and adding, official travel partner of hannover messe in india, comfortable travelling by our luxury charter coaches, indian meals by our chefs on tour gives flavor of home, our interactive industry nites - a unique way to exchange business ideas, a unique way to explore nearby destinations with our add on tours after business, opportunity to join your family and friends on add on tours, we also organize customised corporate incentive tours, we take you to the business places.

Rainbow Trade Fair Tours is India’s leading business tour operator offering economical tour packages for your trade exhibition visit. With a specialized trade fair tour operator like us, you can focus on your business without being bothered about anything. Economical tour packages for your trade exhibition visit.

The China International Medical Equipment Fair (CMEF) is a world leading medical and health technology platform, provides a comprehensive display of technological advancements and solutions from across the entire medical industry chain. CMEF is dedicated to industry trends, technological innovation, and fostering future business opportunities and development, contributing to the global advancement of the medical industry

Wire & Tube

WIRE Düsseldorf is an international trade fair for the wire and cable industry. It is part of the larger wire and Tube Düsseldorf exhibition, which takes place every two years in Düsseldorf, Germany. The event is organized by Messe Düsseldorf and serves as a premier platform for showcasing products, machinery, and technologies related to the wire, cable, and tube industries.

Hannover Messe

Hannover Messe, often referred to simply as "Hannover Fair," is one of the world's largest industrial trade fairs. It takes place annually in Hannover, Germany, and is organized by Deutsche Messe AG. Hannover Messe is a significant event for professionals and companies involved in various industrial sectors, and it serves as a platform for showcasing the latest innovations, technologies, and products.

CHINAPLAS is Asia's No.1 and the world's No.2 plastics and rubber trade fair approved by UFI and exclusively sponsored by the EUROMAP in China.

In 2024, the international print industry will once again meet at drupa, the world's leading trade fair for print technologies. The world's leading trade fair stands for inspiration, innovation, top-class knowledge transfer and intensive networking. Exhibitors still have the opportunity to register for drupa 2024 and secure their place among the leading companies and top decision-makers in the print industry.

ACHEMA is the world's leading trade fair for the chemical engineering and process industry. It is organized by DECHEMA (Society for Chemical Engineering and Biotechnology) and takes place every three years in Frankfurt, Germany. ACHEMA is a significant event for professionals and companies in the chemical, pharmaceutical, and biotechnology sectors.

Chemspec Europe showcases products like Biotechnology, Oilfield chemicals, Colors & dyestuffs, Agro chemicals, Contract & toll manufacture, Cosmetics, Healthcare, Pharmaceutical, Water Treatment And many more etc. in the Chemicals & Dyes industry.

CPHI China was initiated as the showcase of APIs and has gradually developed into a large-scale comprehensive service platform connecting the entire pharmaceutical industry chain in Asian-Pacific region. For two decades, CPHI China has borne witness of the ever-reforming pharma industry, trailed every pace of growth and progress of the pharma manufacturers.

Automechanika

Automechanika Frankfurt is the world's leading trade fair for the automotive service industry. At the international meeting place for industry, repair shops and automotive trade premieres are celebrated and trends are set.

CPhI Worldwide

CPhI (short for "Convention on Pharmaceutical Ingredients") is a series of global pharmaceutical trade shows organized by Informa Markets. These events are considered some of the most significant and comprehensive pharmaceutical exhibitions in the world. CPhI events bring together professionals and companies from various sectors of the pharmaceutical industry to showcase products, share knowledge, and facilitate networking and business collaborations. *Please check events official website for event related information.

MEDICA is one of the world's largest and most prestigious trade fairs for the medical and healthcare industry. It takes place annually in Düsseldorf, Germany, and serves as a global platform for the presentation of medical products, technologies, and services. MEDICA encompasses a wide range of sectors within the healthcare industry, making it a comprehensive event for professionals in the field.

Bauma China

bauma CHINA is the International Trade Fair for Construction Machinery, Building Material Machines, Mining Machines and Construction Vehicles.: it is the heartbeat of the industry and international success engine, innovation driver and marketplace.

Arab Health

Arab Health is the International Hospital, Medical Equipment, and Services Exhibition & Conference. It is a great opportunity where you can access all kinds of medical products, innovations, and services under one roof. It is the ideal place for distributors to find all the supplies and materials we need in one place. Lots of exhibitors will get a unique scope for the business promotion in the global markets.

Medlab Middle East is a leading laboratory and flagship exhibition and conference. It is unarguably the all-encompassing event for every specialism within the laboratory management and diagnostics spectrum. Products from Medical Research & Development & Scientific Instruments industries get exhibited. The Conference provides education, best practice and the chance to learn, meet and network with leading laboratorians from across the globe.

The World's Leading Trade Fair for Construction Machinery, Building Material Machines, Mining Machines, Construction Vehicles and Construction.

iba is the worldwide meeting place for experts from the baking industry in unique dimension at the highest professional level. It is the platform for innovations from the entire trade and provides a complete overview of all novelties on the market. In short: iba is the world's leading trade fair for the baking and confectionery industry - since 1949!

SCHWEISSEN & SCHNEIDEN

Held at Messe Essen, Germany, the Schweissen & Schneiden is an industrial trade fair for welding trade. Organizing by Messe Essen GmbH, the event will prove to be a major hub of renowned professionals of the respective sector.

Drinktec is the world's leading trade fair for the beverage and liquid food industry that displays some of the finest products and services from the field of beverage technology.

EMO Hannover 2025 will be, once again, a meeting point for the most qualified operators of the industry, interested in planning new investments in production technology.

The world's largest trade fair is the most important industry meeting point with over 7500 exhibitors and more than 170000 visitors and as such, the No.1 Food and Beverage business event. Anuga will once again feature the world's most relevant innovations and topics for the international trade audience. With 10 trade shows under one roof, an exciting congress and event programme and over 280000 square meters of business opportunities, the Anuga Food & Beverage fair is a must.

K is considered the leading international trade fair in the plastics and rubber industry. Each time, the event attracts a large number of professionals from production, processing and related sectors such as mechanical engineering, the automotive industry, electronics, medical technology, the packaging industry and the construction industry from all over the world to find out about the latest innovations and make valuable contacts. A wide range of products and services in the fields of machinery, equipment, raw materials and measuring technology will be presented.

Agritechnica

Agritechnica is a leading international exhibition for agricultural machinery and equipment. This event showcases products like tractors, transport, technology for tillage and seedbed preparation, seed technology, ordering equipment, fertiliser technology, plant protection technology, irrigation technology, extraction technology, harvesting technology, and equipment.

Interschutz

This event showcases products like Control and monitoring systems, Individual Devices for Electronic Security Systems etc. in the Security & Defense industry.

Words of Gratification

-JITENDER LAKOTIA

You focus on the business and let us take

Care of all your travel needs..

Get benefit from our vast travel experience, trustworthy overseas partners, seamless services and dedicated costumer service.

Years of Experience

Exhibitions every year, delegates to overseas fairs, across the country, yoy growth rate.

Great experience and very well coordinated tour coordinated

Accommodation during a business trip is the next important

We offer comfortable and best transfers to ensure transfers to ensure

Indian Meals

After a hectic day at business, all you require is good food require is

Our Gallery

• Tour Type City Tours COVID-19 Packages Desert Safari Dhow Cruise Family Individual Visa Services
• Search Tours

OUR SERVICES

Desert Safari

Dhow Cruise

Visa Services

Covid-19 packages.

In the era of COVID-19 for Desert Safari Dubai, 8 rules and instructions recommended by DTCM one 4×4 can take only two individuals and for a family up to five family members. Our price listing has changed until further notice from DTCM. All customers shall wear FACE MASK and GLOVES for safety. See all COVID PACKAGES

Dubai City Tour and Desert Safari ‘Dune Bashing Only’ – For Families

VIP Desert Safari Dubai are full of lavish events, However, Luxurious Arabian Night Fun is for those who want to

Desert Safari ‘Dune Bashing Only’ – For Families

A trip to the sandy Emirates is not complete if you do not drive at full speed in the pristine

Desert Safari ‘Dune Bashing Only’ with Dinner at Cruise Marina Side – For Families

Devote a memorable night in the desert on this overnight desert safari and enjoy “Camping” under the stars of the

All Day Tour Special – For Families

In the era of COVID-19 for Desert Safari 8 rules and instructions recommended by DTCM one 4×4 can take only

Desert Safari ‘Dune Bashing Only’ – For Individual

Desert safari ‘dune bashing only’ with dinner at cruise marina side – for individual.

Desert Safari ‘Dune Bashing Only’ with Dinner at Cruise Creek Side – For Individual

This excursion is marked by adventure. By quad, camel and 4×4, prepare to experience thrills in the Evening Desert Safari. By

Dubai City Tour and Desert Safari ‘Dune Bashing Only’ – For Individual

VIP Desert Safari are full of lavish events, However, Luxurious Arabian Night Fun is for those who want to celebrate

MOST POPULAR TOURS

Vip Desert Safari (Pvt 4×4 Car With Vip Services)

Quad Bike tour With Pvt Pickup (Min 2 Pax)(1hr/half hr)

Find the best quad bike tour in Dubai, under our experienced supervisors and instructors, and after having been taken to

Overnight Desert Safari (Pickup 4×4)

Devote a memorable night in the desert on this overnight desert safari and enjoy “Camping” under the stars of the

Evening Desert Safari+Quad Bike With Bus

Desert evening safari trusts tour and cultural activities with quad bike. First head out into the desert with a driver

WHY CHOOSE US?

Diverse destinations, value for money, beautiful places, passionate travel, testimonial.

Evening Desert Safari (4×4 Pickup)

Abu dhabi city tour sic, musandam tour sic.

Copyright ©️ 2021 Royal Eagle Tourism LLC

• Weather Updates
• Dubai Public & Private Holidays 2024
• Dubai Metro
• Add Your Business

Your Dubai Guide

Double Rainbow Spotted out in Dubai March 2024

Table of Contents

Double Rainbow Dubai

Have you seen double rainbow during rains in dubai.

Yes, unbelievable Double Rainbow is very rare and was seen by many people in Dubai which goes viral in Facebook, Instagram, YouTube and more.

Generally Rainbow gives more shine and Double Rainbow shows Happy face on everyone.

How Double Rainbow occurs?

Usually after rains stopped, Sun Occurs Causing Rainbow. When the light is reflected double times inside the water droplets, two arcs will be formed with 7 colors of rainbow in the sky.

Double Rainbow seen in Dubai Discovery Garden-March 9th 2024

Resident from Dubai discovery Garden Spotted out the double Rainbow and took a pic. What a wonderful view!!!

Double Rainbow seen in Dubai Sports City-March 9th 2024

Another resident from Dubai sports city spotted out the double Rainbow nearby their residence. Really happy to see.

Dubai Raining in 2018

Leave a reply cancel reply.

Your email address will not be published. Required fields are marked *

This site uses Akismet to reduce spam. Learn how your comment data is processed .