Simple Flying
The giant with premium economy: inside emirates' airbus a380.
The Emirates Airbus A380 is always a highlight at the Dubai Airshow, and this year, the aircraft had something a little different to offer. Emirates brought along one of its newest A380s, A6-EVQ, featuring the new premium economy cabin launched just under a year ago. Naturally, Simple Flying jumped at the chance to have a look around the aircraft.
As mentioned, A6-EVQ is one of the younger Airbus A380s in Emirates' colossal fleet of the giant. Since its delivery flight on October 7th, the jet has already flown to Paris, London, Vienna, and Frankfurt. On November 11th, the plane completed an hour-long flight down to the Al Maktoum International Airport, also known as Dubai World Central (DWC).
Entering in economy
Boarding the aircraft took place from the exit row behind the wing, the fourth exit on the main deck of the plane. There, 'passengers' were greeted by a pair of Emirates flight attendants, along with ten abreast seating in a 3-4-3 configuration. Onboard the newer four-class cabin jets, there are 338 economy seats.
When Emirates revealed its new premium economy cabin, the airline also revealed that the whole cabin of the aircraft would be getting a makeover, not just the new fourth cabin. The economy seats onboard, typically accessed by a jet bridge to the second entrance, are spruced up. They are based on the seats installed in the airlines' 'gamechanger' Boeing 777 aircraft but have been upgraded to include full leather headrests, a wood effect tray table, and a 13.3-inch IFE screen.
Up the stairs to the bar
Passengers will seldom be able to use the rear spiral staircase on Emirates' Airbus A380s, as only business and first class passengers are eligible to use the bar. This is why it feels so special using it, even if the aircraft is on the ground.
Climbing the staircase takes you to a corridor past a crew rest area. Past this, passengers arrive in the onboard bar. On the new four-class aircraft, the bar has been spruced up to feature champagne-colored seating. On the right of the plane is a coffee table that will seat four. Meanwhile, on the left is a booth that will also sit four at a slightly higher table. Each day, the bar and other aircraft areas are decorated with freshly picked flowers such as orchids.
A range of refreshments can be whipped up at the bar, ranging from spirits to long drinks and cocktails. Of course, non-alcoholic beverages are also on offer. Emirates will soon be auctioning off the bar taken from its first Airbus A380 .
Stay informed: Sign up for our daily and weekly aviation news digests.
A refreshed business class cabin
Ahead of the bar is the business class cabin. Onboard this particular aircraft, it consists of 76 seats. The seats retain the champagne upholstery of the onboard bar, carrying these forwards. Tied with wood finishings, the cabin is intended to reflect the look and feel of a private jet.
The seats are staggered in a 1-2-1 layout, meaning that every passenger has direct aisle access. This means one window seat will be right by the window, while the one in front will have a table between the seat and the window but no divider from the aisle. The same is the case in the middle seats. The rows alternate between the middle seats being together and separated by tables.
Each seat can change into a lie-flat bed and offers a personal mini-bar, perfect for when you're thirsty but don't fancy walking to the bar or waiting for a drink to be brought over by a flight attendant.
First - where the magic happens
The first class cabin is really where the party is at onboard the Emirates Airbus A380. 14 first class suites are spread in a 1-2-1 pattern. There is no overlap between the suites, unlike business class, where somebody else's feet are in a box near your head.
The seats have a vast high-definition display, a hidden motorized bar, a cosmetic tray with hidden mirrors, and much more. Each of the suites has a fully closing door to ensure the comfort of the passengers inside, along with motorized window blinds. Passengers can use a tablet to control the inflight entertainment system, and of course, the seating positions are also controlled by buttons.
The highlight of the Emirates first class cabin is hidden behind a couple of doors at the very front of the cabin. The aircraft's enormous washrooms are more akin to a private bathroom in the skies. Not only is there ample space to move around and change, but the restrooms also include a luxury sink area. We still haven't mentioned the best bit, though.
You'll need the space to get changed before you step into the shower at the rear of the room. A relative oddity in an aircraft, the showers are set on a timer. Unfortunately, tall people may have to crouch down slightly to shower effectively. Given the taper of the fuselage at the front of the jet, there wasn't really enough room to stand up straight as a 6ft 3in individual.
What about premium economy
Emirates saved the newest cabin for last when showing off its latest Airbus A380 cabin configuration. Step down the main staircase at the front of the jet, and you'll find yourself at the front of the brand new premium economy cabin, which took to the skies less than a year ago.
The cabin consists of 56 seats, with a slightly less dense arrangement than the main economy cabin. Two seats have been removed from each row to give an eight abreast layout of 2-4-2. The seats are 19.5 inches wide and have a pitch of 40 inches.
The seats are made from stain-proof cream leather and also have the wood panel finish found in the business class cabin. A six-way adjustable headrest accompanies calf and footrests.
Last week Simple Flying revealed that Emirates will begin marketing the new premium economy cabin in June 2022 . The airline is set to roll out the new cabin on a vast number of aircraft over the coming years .
Want to read what it's like to travel in the premium economy cabin? Please keep a lookout for our written flight review coming later this week.
What is your favorite cabin onboard the Emirates four-class Airbus A380? Let us know your thoughts in the comments!
- Planes & Seat Maps
Emirates Planes and Seat Maps
- Airbus A380-800 (388) Three Class Layout 1
- Airbus A380-800 (388) Three Class Layout 2
- Airbus A380-800 (388) Two Class
- Boeing 777-200LR (772) Three Class
- Boeing 777-300ER (77W) Three Class Layout 1
- Boeing 777-300ER (77W) Three Class Layout 2
- Boeing 777-300ER (77W) Two Class
Fleet Information and Seat Maps
Widebody jets, economy class, business class, first class.
SeatGuru was created to help travelers choose the best seats and in-flight amenities.
You can unsubscribe at any time. Please see our Privacy Policy .
COUNTRYPICKERWESELECTEDHEADERMESSAGE
COUNTRYPICKERWESELECTEDMESSAGE click here
Cookies: We use cookies to improve your experience on this website. By continuing to browse our website, you are agreeing to use our site cookies. Please read more here
Choose your country and language
- The Americas
- The Middle East
- Asia & South Pacific
- All-Inclusive
- Beach Holidays
- City Breaks
- Family Holidays
- Multi-Centre Holidays
- Romantic Retreats
- Ultimate Luxury
Middle East
- Ras Al Khaimah
Indian Ocean
Rest of the world.
- Australasia
- Early Booking Offers
- Last Minute Escapes
- Skywards Offers
The Emirates Holidays Experience
At Emirates Holidays we understand that your holiday should be tailor-made around experiences that you will never forget. We create holidays suited to everyone, whether you’re looking for a family adventure on a safari , a romantic retreat in the Indian Ocean or a life-changing tailor-made tour of a destination, which can be personalised to your needs. We offer relaxing spa retreats to unwind overlooking crystal blue waters, the chance to experience new cultures on our city breaks , and the opportunity to travel on all-inclusive holidays where your flights, food and beverages are all included in the total package for outstanding value for money.
You can call our team of expert travel consultants to help you understand the details of your holiday and offer insights into your chosen destination. Our award-winning Emirates airline fly all over the world so you can travel with ease to Europe, South America, North America, Australasia, Far East Asia and of course our home city, a central global hub and network to all of these destinations around the world - Dubai .
Browse our destination pages online and should you want to book a package, please call our expert travel consultants for further details and to finalise completing your dream holiday. Remember the sooner you book, the more likely you are to be eligible for savings, complimentary upgrades , extra room nights or board basis that are an added bonus to your ideal holiday.
Explore more
European Holidays
Asia Holidays
Award-winning Emirates
Dubai Holidays
Mauritius Holidays
Maldives Holidays
Join the emirates holidays community.
Sign up to receive exclusive offers and new holiday inspiration direct to your inbox.
We're always looking for new ways to inspire your next holiday - fascinating destinations, unique hotels and all the little things that come together to create unforgettable moments for you and your family.
Why Emirates Holidays?
- Personalised holidays
- Support at every step
- Get more for your money
- Fly Better with Emirates
- Enjoy rewards with Emirates Skywards
For more information, please click here
- Recent Hotels 0 You do not have any recently viewed hotels.
- Shortlist 0 Your hotel shortlist is empty!
- Recent Searches You do not have any recent searches
Please refresh this page
This page is not showing your most up to date flight and/or hotel selection. You have made an update to your flight and/or hotel selection on another page.
Emirates Reveals First 9 Destinations for New Airbus A350: Is Your City on the List?
Gordon Smith , Skift
May 6th, 2024 at 7:25 AM EDT
The Emirates A350 is one of the year's most hotly anticipated aircraft launches. We now know when it'll make its debut and which cities will see it first.
Gordon Smith
Emirates is famed for its extravagant service onboard its current fleet of Boeing 777s and Airbus A380s. It’s therefore little surprise that expectations are high for its incoming A350s – an aircraft that has been years in the making.
On Monday, the carrier confirmed not only when the plane will make its debut, but also where.
Emirates’ first A350-900 is due to make its maiden flight this September. An initial roster of nine global destinations will be served, with Dubai to Bahrain the very first route to see the new jet. From September 15, Flights EK839 and EK840 between the two cities will be A350-operated.
At a distance of just 263 nautical miles, the aircraft will be in the air for less than an hour. Emirates says a second-daily A350 service will ply the route from November 1 as more aircraft are delivered.
It is common for airlines to introduce a new plane type on a ‘soft launch’ basis. This typically includes flying shorter routes to bolster crew familiarization. It also offers the company a chance to iron out any teething issues before the plane flies more complex long-haul services.
First Destinations for the Emirates A350
After Bahrain on September 15, a further eight cities are due to be operated by the A350. On September 16, a day after the Bahrain inaugural, Emirates’ daily EK853/4 from Dubai to Kuwait will join the A350 club.
Looking further afield, India will be the first country outside of the Middle East to see the new plane. From October 27, the A350 will fly from Dubai to both Mumbai and Ahmedabad (operating Flights EK502/3 and EK538/9).
Things ramp up further from November 4, when the plane makes its European debut.
Emirates is not only restarting its Edinburgh route but is doing so in style, by rostering its newest plane. The Scottish capital is due to rejoin the network after flights were suspended during the pandemic. Edinburgh is the last UK city to return to the airline’s post-crisis route map.
A Flurry of December Launches
As the busy holiday season approaches, Emirates is adding three further A350 destinations.
From December 1, the French city of Lyon, Bologna in Italy, and Oman’s capital Muscat switch to the new plane. Information about which specific services are operated by the A350 can be found on the Emirates website .
The final A350 destination announced so far is Colombo in Sri Lanka, with one of four daily frequencies served from January 1.
How Many A350s Will Emirates Have?
Emirates expects its first 10 A350s to join the fleet before the end of March 2025. Further destinations are due to be announced in the coming months.
All of the initial set of 10 planes are planned to serve short and medium-haul cities. These aircraft have a three-class setup, with 32 “next-generation” business class seats, 21 in premium economy, and 259 economy options.
The company has a further 55 of the European-built jets on order. A separate deal for dozens of the larger -1000 variant is believed to be under negotiation.
The developments come just days after Air India brought its A350 to Dubai for the first time.
The recently privatized airline is in the middle of a five-year transformation plan that promises to bring Air India back to its world-class glory. One of the key metrics for success is removing the need for so many Indian passengers to transit through the Middle East.
Speaking at the Skift India Summit in March, Air India CEO Campbell Wilson said this would give passengers “a much faster, much more convenient, much less emissive way to get from A to B.”
Airlines Sector Stock Index Performance Year-to-Date
What am I looking at? The performance of airline sector stocks within the ST200 . The index includes companies publicly traded across global markets including network carriers, low-cost carriers, and other related companies.
The Skift Travel 200 (ST200) combines the financial performance of nearly 200 travel companies worth more than a trillion dollars into a single number. See more airlines sector financial performance .
Read the full methodology behind the Skift Travel 200.
Skift India Report
The Skift India Report is your go-to newsletter for all news related to travel, tourism, airlines, and hospitality in India.
Have a confidential tip for Skift? Get in touch
Tags: a350 , a380 , air india , airbus , airlines , dubai , emirates , middle east , Middle East tourism
Photo credit: Emirates Airbus A350 Emirates
- Newsroom Emirates
Emirates to retrofit an additional 71 A380s and B777s, extending airline’s nose-to-tail cabin refreshes to 191 aircraft
Move ensures product consistency across fleet and more refreshed aircraft in active service well into the mid-2030s
DUBAI, UAE 7 May 2024: Emirates has today unveiled that it will be completely refurbishing another 43 A380s and 28 Boeing 777 aircraft, expanding its retrofit programme to 191 aircraft.
The original plan called for 120 aircraft - 67 A380s and 53 777s to undergo full refurbishment. The Boeing 777 remains the backbone of the Emirates fleet, and the A380 is the airline’s flagship customer favourite, and the expansion of the refurbishment programme ensures Emirates continues to provide customers with an unparalleled travel experience.
Sir Tim Clark, President Emirates Airline said : “We’re topping up our multi-billion dollar investment in the retrofit programme to introduce cutting-edge cabin products on more of our A380s and Boeing 777s, demonstrating a clear commitment to elevating the customer experience with a best-in-class suite of products across every cabin. The addition of more aircraft fitted with our newest generation seats, updated cabin finishings and a contemporary colour palette also marks a significant step in ensuring more customers can consistently experience our premium products across both aircraft types.”
Emirates has retrofitted 22 A380 aircraft so far, and in July of this year, the first Boeing 777 will undergo an interior refresh. Each Boeing 777 aircraft will take approximately two weeks to refurbish before entering service. Plans include the refurbishment of the First-Class cabin, all new Business Class seats making a debut on the aircraft in an updated 1-2-1 seating configuration, in addition to 24 of the latest Premium Economy seats, giving customers more premium options to choose from.
Along with the addition of the Premium Economy cabin, the Emirates Boeing 777 will be configured with 332 seats in four classes, featuring eight First Class suites, 40 Business Class seats, and 260 Economy Class seats. To make room for the new Premium Economy cabin, 50 Economy seats will be removed.
Refurbishment work for the Emirates fleet is completely being managed and executed in-house at the airline’s Engineering Centre, with over 250 project personnel currently working round the clock, supported by 31 major partners and suppliers who have set up workshops both in the facility and offsite to deliver the refreshed cabins.
Once the last aircraft rolls out of the retrofit programme and the project is fully complete, the airline will have installed 8,104 next-generation Premium Economy seats, 1,894 refreshed First Class suites, 11,182 upgraded Business Class seats and 21,814 Economy Class seats.
Emirates currently operates its refurbished A380 aircraft fitted with Premium Economy to New York JFK, Los Angeles, San Francisco, Houston, London Heathrow, Sydney, Auckland, Christchurch, Melbourne, Singapore, Mumbai, Bangalore, Sao Paulo and Dubai. The airline will be boosting services with the new cabin to Osaka in early June.
The airline will be serving 42 cities with Premium Economy by February 2025 with the A350 entering its fleet in September of this year, in addition to the newly refurbished Boeing 777s also slated to begin serving more cities with the highly sought after cabin later this summer.
More Information
About emirates.
The Emirates story started in 1985 when we launched operations with just two aircraft. Today, we fly the world’s biggest fleets of Airbus A380s and Boeing 777s, offering our customers the comforts of the latest and most efficient wide-body aircraft in the skies.
We inspire travelers around the world with our growing network of worldwide destinations, industry leading inflight entertainment, regionally inspired cuisine, and world-class service.
Find out more
Annual reports
You can download the latest annual report or read our previous reports for detailed information on our commercial results and strategies.
Download reports
Media contacts
If you want to get in touch with our media team, please mail us on:
If you're a customer and you have a general question about our services or would like some help, please visit our help centre .
Disclaimer: Information contained in the press releases published on our media centre is accurate at the time of publication.
Mega upgrade: Emirates announces 9 destinations for new A350 aircraft
From Edinburgh in the UK to Ahmedabad in India, Emirates will be introducing its new A350 across a host of routes
Emirates, the UAE’s national carrier, announced the first set of destinations to be served by its A350 aircraft entering service in September 2024.
Announcing the new additions at the ongoing Arabian Travel Market 2024, Emirates revealed that 10 new A350s are expected to join the airline’s fleet by March 2025 and the airline plans to deploy its latest aircraft type to 9 destinations in the coming months.
These new A350 aircraft will offer three cabin classes, with 32 Business Class seats, 21 seats in Premium Economy, and 259 generously pitched Economy Class seats.
All of these aircraft are earmarked to serve short to medium haul cities on the Emirates network, with Bahrain as its inaugural destination, said the airline during the announcement made at the Arabian Travel Market 2024 .
The first destinations to be served by our A350 aircraft have just been announced at @ATMDubai , beginning with Bahrain in September. https://t.co/kWpRq9hdE6 pic.twitter.com/a6aIXnoexr — Emirates (@emirates) May 6, 2024
As the first Emirates A350s begin entering the fleet, the airline will offer customers more opportunities to experience its Premium Economy product and sample its next generation Business Class cabins for the first time, particularly on short and medium haul routes in the Middle East and GCC, West Asia and Europe.
Adnan Kazim, deputy president and CCO, Emirates Airline said, “The A350 will be a game-changer for Emirates, enabling us to serve regional points with superior operating efficiency and flexibility across the Middle East and GCC, West Asia and Europe. With the latest generation cabin products including more of our sought-after Premium Economy to more cities, top-notch in-flight entertainment technologies and an abundance of other customer-friendly features, the Emirates A350 builds on our long-standing commitment of investing in the very best customer experience in the sky.
“Flying the A350 to 9 cities in such a short span of time adds more premium cabin options and choice across geographies for our customers, and ensures we maintain our competitive edge and industry leading position.”
In the GCC Emirates will operate its first A350 to Bahrain on the daily EK839/840 service from 15 September. Frequency of A350 services will progressively increase to cover two Bahrain services with the second service starting on 1 November.
The first Emirates A350 will land in Kuwait on the daily EK853/854 service on 16 September.
Muscat’s daily EK866/867 will be served by the A350 from 1 December.
In South Asia The Emirates A350 will be deployed on EK502/503 to Mumbai from 27 October.
Ahmedabad’s daily EK538/539 will be served by the A350 from 27 October.
Colombo’s fourth daily service EK654/655 will be served by the A350 from 01 January 2025.
In Europe Lyon will be served daily with the Emirates A350 from December 2024.
Bologna will be served by the A350 from December.
Edinburgh will rejoin the Emirates network from November, operated by the A350.
Emirates will announce more destinations in the coming months as new aircraft join its fleet. The airline has 65 A350-900s on order, and are expected to enter service in the coming years.
You might also like
Emirates Group announces best ever performance with profits up 71%
DET, Emirates partner to jointly promote Dubai’s tourism hub status
Sheikh Ahmed addresses the question of an Emirates IPO
Dubai’s Emirates Airline expands retrofit programme to 191 aircraft
Every 51st resident in dubai is a millionaire, reveals world’s wealthiest cities report, abu dhabi pilots mena’s first passenger-carrying drone flights, gulf business may 2024 roundup: mastercard, supercar blondie and more, latest issue.
- Saudi Arabia
- Real Estate
- Special Report
- Art & Culture
Advertise With Us
Privacy policy.
© 2021 MOTIVATE MEDIA GROUP. ALL RIGHTS RESERVED.
Emirates' chairman has a message for Boeing: 'Get your act together'
One of Boeing ’s biggest customers issued a call to action to its new management team, expressing frustration with the safety crisis facing the American planemaker and the consequent delays in order deliveries.
“We’re not happy really with what’s going on, we always really wanted to see this aircraft entering the fleet when it had been promised — and there is a delay, it’s not only to us,” Sheikh Ahmed bin Saeed Al Maktoum, chairman and CEO of Dubai’s flagship Emirates airline, told CNBC’s Dan Murphy on Tuesday at the Arabian Travel Market in Dubai.
With 245 passenger planes and five 778 freighters on order, Emirates is Boeing’s largest customer in terms of widebody jets. But aircraft deliveries by the manufacturer dropped in the first quarter of 2024 to the lowest number since mid-2021 as the company deals with increased scrutiny after a door plug blew out from one of its 737 Max 9 planes midair in January.
The company delivered 83 planes in the three months to March 31 — most of them narrowbody 737s — compared to 157 in the prior quarter and 130 planes in the year-earlier period.
Al Maktoum, who sits at the helm of the world’s largest long-haul airline and helped launch it in 1985, echoed the sentiments of many other airline CEOs when it comes to expectations of Boeing.
“I think they have to put a lot of pressure in order to make sure that they deliver to the customer whatever they promised,” he said.
Asked if he had a message for the planemaker, Al Maktoum said: “I always say, you know, get your act together and just do it. And I think they can do it.”
CNBC has contacted Boeing for comment.
The chairman did not indicate that Emirates would cancel the Boeing orders or move them to its French rival, Airbus .
“No, no — I won’t be able to say exactly what we are planning,” he replied when asked about the likelihood of such a move. “But I think you see that we are refurbishing a big number of aircraft within the existing fleet ... And there will be no shortage within Dubai capacity.”
He cited the airline’s extension of part of its existing fleet, including the mammoth double-decker Airbus A380s, as helping provide sufficient passenger capacity.
The recently-appointed new management team at Boeing is now tasked with navigating the company’s worst crisis since 2018-2019, during which time two of its new 737 Max jets crashed within a period of six months, killing 346 people.
Following the Alaska Airlines door blowout in January, the Federal Aviation Administration’s six-week audit of Boeing and Spirit AeroSystems “found multiple instances where the companies allegedly failed to comply with manufacturing quality control requirements,” according to an FAA release published March 4.
“The FAA identified non-compliance issues in Boeing’s manufacturing process control, parts handling and storage, and product control,” it said. The regulatory agency said it informed Boeing’s leadership that it “must address the audit’s findings as part of its comprehensive corrective action plan to fix systemic quality-control issues,” and address its “safety culture.”
In a previous statement cited by CNBC, a Boeing spokesperson said in response to the FAA findings that the company continues “to implement immediate changes and develop a comprehensive action plan to strengthen safety and quality.”
The company’s website says it continues to support the U.S. NTSB and FAA investigations of the Jan. 5 accident.”
CNBC’s Leslie Josephs contributed to this report.
More from CNBC:
- Renters' hopes of being able to buy a home have fallen to a record low, survey shows
- Social Security now expected to run short on funds in 2035, one year later than previously projected, Treasury says
- Abortion bans drive away up to half of young talent, CNBC/Generation Lab youth survey finds
Natasha Turak is a correspondent for CNBC.
We've detected unusual activity from your computer network
To continue, please click the box below to let us know you're not a robot.
Why did this happen?
Please make sure your browser supports JavaScript and cookies and that you are not blocking them from loading. For more information you can review our Terms of Service and Cookie Policy .
For inquiries related to this message please contact our support team and provide the reference ID below.
File : Flag of Elektrostal (Moscow oblast).svg
File history, file usage on commons, file usage on other wikis.
Original file (SVG file, nominally 603 × 393 pixels, file size: 39 KB)
Structured data
Items portrayed in this file, copyright status, copyrighted, copyright license, creative commons attribution-sharealike 2.0 generic, creative commons attribution-sharealike 1.0 generic, gnu free documentation license, version 1.2 or later, creative commons attribution-sharealike 2.5 generic, creative commons attribution-sharealike 3.0 unported, source of file, original creation by uploader, 31 august 2007.
- SVG flags of cities and villages of Moscow Oblast
- Culture of Elektrostal
- License migration redundant
- CC-BY-SA-3.0,2.5,2.0,1.0
- Self-published work
IMAGES
COMMENTS
Enter Experience. Explore the Emirates A380 or Boeing 777 using our 3D experience. Choose an aircraft, then select a cabin class to sample our inflight products and features. Explore the Emirates A380 or Boeing 777 using our 3D experience. Choose an aircraft, then select a cabin class to sample our inflight products and features.
Fly in comfort on the Emirates A350 with new seat features, upgraded entertainment and an elegant interior design. We'll share news about further features of our new aircraft soon. Our first Emirates A350 aircraft will have three cabin classes, including 32 new Business Class seats offering space and privacy, 21 seats in Premium Economy, and ...
Plan and book tours and activities in your destination with our partners GetYourGuide.com. Find deals on the best things to do on your travels and earn Skywards Miles at the same time. Choose from over 23,000 things to do, seamlessly book your tickets online, skip the lines, and experience personalized tours with vetted locals.
43,100 feet. Aircraft Specifications B777-200LR. Seat capacity. 2 class - 302 seats. Wingspan. 212 feet 7 inches / 64.8 meters. Length. 209 feet 1 inch / 63.7 meters. Height.
Published Jan 31, 2021. Simple Flying recently got a chance to tour an Emirates Boeing 777-300ER. The Boeing 777-300ER has been the workhorse of the Emirates fleet for well over a decade, alongside the Airbus A380. The 777-300ER has a range of 7,888 nautical miles, and the aircraft type has flown over 298 million passengers since its introduction.
A flight that's out of this world. The first of our brand new A380 aircraft has arrived with a refreshed interior and the latest generation of luxury seats. Step into a light and spacious cabin of cream tones and textured bronze waves, with the motif of the UAE national tree throughout. Our latest A380 also features our new Premium Economy ...
More than 220,000 passengers have flown the two-class A380 on over 450 flights since it first entered service in December 2015. The Emirates' two class confi...
Choose from themed experiences, authentic tours, hundreds of activities, and enjoy exclusive flight discounts with Dubai Experience. Create your itinerary, add or book your flights, and get ready to experience the UAE. Interactive itinerary planner; Mix and match tours and activities; Desert trips, Downtown glamour, and more
Ever wanted to know what the EMIRATES Airbus A380 looks like on the inside? This Cabin Tour will bring you the answers - featuring FIRST, BUSINESS and ECONOM...
The Emirates' three-class configured A380 features 14 luxurious private suites in First Class, 76 flatbed seats in Business Class and 426 spacious seats in E...
Watch our pilots give an immersive 360-view tour of the flight deck controls of an Emirates A380, the world's largest commercial aircraft. To enjoy the 360-v...
Published Dec 2, 2019. The Airbus A380 is a major component of the Emirates fleet. Operating the world's largest fleet of the type, the airline has committed to flying the Airbus A380 until at least 2030. At the Dubai Airshow, Emirates invited us onboard their Airbus A380 to take a look around!
Emirates brought along one of its newest A380s, A6-EVQ, featuring the new premium economy cabin launched just under a year ago. Naturally, Simple Flying jumped at the chance to have a look around the aircraft. As mentioned, A6-EVQ is one of the younger Airbus A380s in Emirates' colossal fleet of the giant. Since its delivery flight on October ...
Boeing 777-300ER (77W) Three Class Layout 2. 69. 20.5. Closed Suite. Seatback TV. All Seats. AC Power. No. Your guide to Emirates seat maps and fleet information, use this before you book or take a flight.
Our award-winning Emirates airline fly all over the world so you can travel with ease to Europe, South America, North America, Australasia, Far East Asia and of course our home city, a central global hub and network to all of these destinations around the world - Dubai. Browse our destination pages online and should you want to book a package ...
Pleasant experience on board Emirates Airbus A380. Warm Welcome by the crew and really impressed by the new Premium Economy
The tours and activities prices and Skywards Miles quoted are dynamic and subject to change, prices quoted at the time of booking are correct. Local taxes may be levied and payable to the Tours and activities company at pick-up. Emirates Skywards programme rules apply. *You cannot both earn and spend Skywards Miles on the same booking.
Emirates' first A350-900 is due to make its maiden flight this September. An initial roster of nine global destinations will be served, with Dubai to Bahrain the very first route to see the new ...
From Dubai Airshow 2019, presented by Airbus. Business Insider's Rachel Hosie takes us on a tour through each class on Emirates' double-decker Airbus A380.MO...
Vacation Packages. 5 nights from $1,045pp Book now. 7 nights from $2,139pp Book now. 7 nights from $2,269pp Book now. 7 nights from $2,529pp Book now.
Emirates to retrofit an additional 71 A380s and B777s, extending airline's nose-to-tail cabin refreshes to 191 aircraft. Move ensures product consistency across fleet and more refreshed aircraft in active service well into the mid-2030s. DUBAI, UAE 7 May 2024: Emirates has today unveiled that it will be completely refurbishing another 43 ...
Emirates, the UAE's national carrier, announced the first set of destinations to be served by its A350 aircraft entering service in September 2024. Announcing the new additions at the ongoing ...
With 245 passenger planes and five 778 freighters on order, Emirates is Boeing's largest customer in terms of widebody jets. But aircraft deliveries by the manufacturer dropped in the first ...
The chairman of Emirates said he's been given assurance by Boeing Co. management that the embattled planemaker will get its house in order following long delays on the 777X widebody, for which ...
In 1938, it was granted town status. [citation needed]Administrative and municipal status. Within the framework of administrative divisions, it is incorporated as Elektrostal City Under Oblast Jurisdiction—an administrative unit with the status equal to that of the districts. As a municipal division, Elektrostal City Under Oblast Jurisdiction is incorporated as Elektrostal Urban Okrug.
Elektrostal , lit: Electric and Сталь , lit: Steel) is a city in Moscow Oblast, Russia, located 58 kilometers east of Moscow. Population: 155,196 ; 146,294 ...
Permission is granted to copy, distribute and/or modify this document under the terms of the GNU Free Documentation License, Version 1.2 or any later version published by the Free Software Foundation; with no Invariant Sections, no Front-Cover Texts, and no Back-Cover Texts.A copy of the license is included in the section entitled GNU Free Documentation License.